KEGG   Arabidopsis thaliana (thale cress): AT5G03660Help
Entry
AT5G03660         CDS       T00041                                 

Definition
(RefSeq) transcriptional activator (DUF662)
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Transcrip_act DUF3584
Motif
Other DBs
NCBI-GeneID: 831768
NCBI-ProteinID: NP_001190218
MIPS: AT5G03660.1
TAIR: AT5G03660
Araport: AT5G03660
UniProt: F4KGP6
Position
5
AA seq 151 aa AA seqDB search
MQPTETSQPAPSDQGRRLKDQLSESMSFSSQMKKEDDELSMKALSAFKAKEEEIEKKKME
IRERVQAQLGRVEDESKRLAMIREELEGFADPMRKEVTMETEYKDALEAFNEKNKEKVEL
ITKLQELEGESEKFRFKKLEELSKNIDLTKP
NT seq 456 nt NT seq  +upstreamnt  +downstreamnt
atgcaaccgacagagacgtcgcagccggcgccgtcggatcaaggccgccggcttaaggat
cagttatcggagagtatgagcttcagtagccaaatgaagaaggaagacgatgagttgtcg
atgaaagctttgtcggcgttcaaggccaaagaagaggagatcgagaagaagaagatggag
atcagagaaagagttcaagctcagcttggtcgtgttgaagatgagtccaagcgtctcgct
atgattcgcgaggaacttgaaggttttgctgatcccatgaggaaggaagttactatggaa
acagagtacaaggatgctcttgaagcattcaatgaaaagaacaaggagaaggtggagctg
atcaccaagctacaggagttggagggagaaagcgagaaattcaggttcaagaagctggag
gagctaagcaagaacattgatctaaccaaaccttag

DBGET integrated database retrieval system