KEGG   Arabidopsis thaliana (thale cress): AT5G11390Help
Entry
AT5G11390         CDS       T00041                                 

Gene name
WIT1
Definition
(RefSeq) WPP domain-interacting protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: FtsK_alpha Tropomyosin
Motif
Other DBs
NCBI-GeneID: 831010
NCBI-ProteinID: NP_196700
MIPS: AT5G11390.1
TAIR: AT5G11390
Araport: AT5G11390
UniProt: Q8L7E5
Position
5
AA seq 703 aa AA seqDB search
METETEHDRTVSVDDNDSLVPEPSSTKESFFEDLSLTGQVMNPQLSSAGEVLTKVELDFA
FVSEKLVNLSLLTMQLGTRENDFESFVSKKEEDEEEPSSNVDDDDDSAEKALEFDLLSSI
LNSEVKELESLLGFLQNEIQSARVMISPFQHDGEAFLDLEGKLNDTEQSLGQLMEQVVEM
KKQSSNFQRLSSGLDEQGSWSGGQTSVSQNDGEFGDLSAKINMQTADQQRNVLRMLEKSL
AKEMELEKKLSESRNTERELEMKLYSSEQDVVYMEEVTEDAFSRWLEADNAAEVFKGTSK
EMSGKLQILQFNLSGSFKREDNLKSKLVDSKERLEAKECALHKLDSSNARLADFLVAQTE
GLKESLQEAEEKLILLNTENSTLSEKVSSLEEQLNEYGIQTEDADATSGALITDLERINE
ELKDKLAKTEARAEETESKCKILEESKKELQDELGNFRDKGFTIHKLASLEKHLRDSDLQ
LEHAVAAVEASKEKQNLLYSTVSDMEDVIEDLKSKVLKAENRADITEEKLIMVSESNAEV
NEELKFFKGRLKEGEKYLQQAEERKLRTAKDIGVHNKIMKKLVMQLAAERERLHKQITNL
SRENCVLMVKLKKVGKTGYMESGNGSEVSPKSDQNASSCHQGSRLQATFISLTNPEEEET
GSKSDIGSVRRLDVGALRFKHILVAILVILISSIAYVISQQNM
NT seq 2112 nt NT seq  +upstreamnt  +downstreamnt
atggaaacagaaacggaacatgatagaactgtctctgtcgatgacaacgacagccttgta
cctgagccaagctcaacgaaagaaagcttttttgaagatctctcgcttactgggcaagtt
atgaatcctcaactttcaagtgcaggcgaagttttgacaaaagttgaattggattttgct
tttgtctctgagaaattggtcaatcttagtcttcttactatgcaactcggcacgagggaa
aatgattttgagtcttttgtttctaagaaagaagaagatgaagaagagccttcgagtaat
gttgatgatgatgatgattctgctgagaaggcattggagtttgatctcttgtcttcaatt
ctcaattcagaggtgaaagaacttgaatcgcttcttggttttctccagaacgagattcaa
agcgcccgtgtcatgatatctccgtttcaacatgatggagaagctttcttggatttggaa
gggaagttgaatgatactgaacaatctttgggtcagttaatggaacaagtagtggaaatg
aagaagcaatcttctaactttcagaggttatcttctggtttggatgaacaaggaagctgg
tctggagggcaaacttcagtgtctcaaaacgatggtgagtttggtgatctgagcgctaag
atcaatatgcagactgctgatcagcaaaggaatgttttaaggatgcttgagaaatctttg
gctaaggagatggaacttgagaagaaactaagtgaatcaagaaatactgaacgagaacta
gagatgaaactgtattcttctgagcaggatgttgtctacatggaagaagtaaccgaagat
gcgttctccaggtggcttgaggcagataatgctgctgaagtctttaagggaacgtcaaag
gagatgtctggaaaactccagattcttcagttcaatctaagtggctcttttaagcgggaa
gacaacttgaagtctaagcttgttgattcaaaggaacgtttagaagctaaggaatgcgcc
ttgcacaagcttgatagcagcaatgcaagacttgctgactttcttgtggcacaaacagaa
ggcttaaaagagagtttgcaagaggctgaagaaaaattgattttgttgaacactgagaat
tccacattaagtgagaaagttagctcccttgaagaacaactgaatgaatatgggattcaa
acagaagatgcggatgctacttctggtgctctgataacagatcttgaacgtatcaacgag
gaactgaaagataaattagccaaaactgaagcaagggctgaggaaacagaatccaagtgc
aaaatcctagaagaaagcaaaaaggagcttcaagacgagttggggaatttcagagacaag
ggcttcactatacataagttagcatcgcttgagaaacacttgagggactcagatctacaa
ctagaacatgcagttgcagctgttgaagcaagtaaagaaaagcagaacttgttatattct
actgtttctgatatggaggatgtgatcgaggatctaaaatcaaaagttttgaaggctgaa
aacagggccgacattaccgaagagaagttgatcatggtatctgagtctaacgcagaggtc
aacgaagaactgaaattctttaagggtagattgaaagaaggggagaaatatttacagcaa
gcagaagaaagaaaattgcgaaccgccaaagatatcggggtacataacaagatcatgaaa
aaactggtcatgcaactagctgctgaacgagaacgacttcataaacagataactaacctg
tcaagagagaattgtgtgttgatggtgaagttgaaaaaggttggaaaaactggttatatg
gaaagtggcaatggaagtgaagtttcaccaaagtcggaccagaatgcttcttcttgccat
caaggaagtagacttcaagccaccttcatttcattaactaatccagaggaggaagaaaca
ggttcaaaatcagatattggaagtgtaaggagattagatgttggagctcttaggttcaaa
cacattctcgttgcaatactcgtgatcttaatatcgtcgatagcttatgttatatcccag
caaaacatgtaa

DBGET integrated database retrieval system