KEGG   Arabidopsis thaliana (thale cress): AT5G40390Help
Entry
AT5G40390         CDS       T00041                                 

Gene name
SIP1
Definition
(RefSeq) Raffinose synthase family protein
  KO
K06617  raffinose synthase [EC:2.4.1.82]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT5G40390 (SIP1)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.82  galactinol---sucrose galactosyltransferase
     AT5G40390 (SIP1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Raffinose_syn
Motif
Other DBs
NCBI-GeneID: 834037
NCBI-ProteinID: NP_198855
MIPS: AT5G40390.1
TAIR: AT5G40390
Araport: AT5G40390
UniProt: Q9FND9
Position
5
AA seq 783 aa AA seqDB search
MASPCLTKSDSGINGVDFTEKFRLEDSTLLANGQVVLTDVPVNVTLTSSPYLVDKDGVPL
DVSAGSFIGFNLDGEPKSHHVASIGKLKNIRFMSIFRFKVWWTTHWVGSNGRDIENETQI
IILDQSGSDSGPGSGSGRPYVLLLPLLEGSFRSSFQSGEDDDVAVCVESGSTEVTGSEFR
QIVYVHAGDDPFKLVKDAMKVIRVHMNTFKLLEEKSPPGIVDKFGWCTWDAFYLTVNPDG
VHKGVKCLVDGGCPPGLVLIDDGWQSIGHDSDGIDVEGMNITVAGEQMPCRLLKFEENHK
FKDYVSPKDQNDVGMKAFVRDLKDEFSTVDYIYVWHALCGYWGGLRPEAPALPPSTIIRP
ELSPGLKLTMEDLAVDKIIETGIGFASPDLAKEFYEGLHSHLQNAGIDGVKVDVIHILEM
LCQKYGGRVDLAKAYFKALTSSVNKHFNGNGVIASMEHCNDFMFLGTEAISLGRVGDDFW
CTDPSGDPNGTFWLQGCHMVHCAYNSLWMGNFIQPDWDMFQSTHPCAEFHAASRAISGGP
IYISDCVGKHDFDLLKRLVLPNGSILRCEYYALPTRDRLFEDPLHDGKTMLKIWNLNKYT
GVIGAFNCQGGGWCRETRRNQCFSECVNTLTATTSPKDVEWNSGSSPISIANVEEFALFL
SQSKKLLLSGLNDDLELTLEPFKFELITVSPVVTIEGNSVRFAPIGLVNMLNTSGAIRSL
VYNDESVEVGVFGAGEFRVYASKKPVSCLIDGEVVEFGYEDSMVMVQVPWSGPDGLSSIQ
YLF
NT seq 2352 nt NT seq  +upstreamnt  +downstreamnt
atggcttcgccgtgtttgaccaagtccgattccggtatcaatggcgttgactttaccgaa
aaattccggttagaagattccactctcttagccaatggtcaagtcgtcttaaccgatgtt
ccggttaacgttactctcacctcttcaccttacttagtcgacaaagacggtgtaccactc
gacgtctctgccggttcattcatcgggtttaacctcgacggagagcccaaaagccaccac
gtggcatccatcggaaaactcaagaacattcgtttcatgagcatattccgtttcaaggtt
tggtggactactcattgggtcggatcaaacggacgtgacatcgagaacgagactcaaatc
atcattcttgatcaatccgggtcggattctggacccggatccgggtcgggtcgtccttat
gttctcttgctacctcttcttgaaggctccttccgttcatcattccaatccggagaagac
gatgacgtggcggtctgtgtcgaatccgggtcgaccgaagtaaccgggtcggagtttcgt
cagattgtgtatgtccatgccggggatgacccgttcaagctcgtgaaagacgccatgaaa
gtgattagggttcatatgaatacgttcaagcttcttgaagagaaatcgccgccgggaatt
gtcgataaattcgggtggtgcacttgggatgctttttacttgacggtgaatcctgacgga
gttcataaaggtgttaagtgtctcgtcgacggtggttgtcctccgggattggttcttatc
gacgacggttggcaatcgattggacatgattccgatggtattgatgtcgaagggatgaat
attaccgtcgccggtgaacaaatgccttgcaggcttctgaagtttgaagagaaccacaaa
ttcaaagactacgtttctccaaaagatcaaaacgacgtcggaatgaaagctttcgtcaga
gatctgaaagatgaattctccaccgttgattacatctacgtttggcacgcactttgcggt
tactggggaggtctccgtcctgaagctccggctctgccgccgtcgaccattatccggccc
gagctctctccaggacttaaactaacaatggaagatctcgccgtcgataagatcatagag
accggaatcggatttgcctcgccggacttggcgaaagagttctacgaaggtcttcactct
catcttcaaaacgccggtattgacggcgttaaagttgatgtcatccacatattggagatg
ttatgccagaaatatggcgggagagttgacttggccaaagcttacttcaaggcgttaacg
tcgtcagtgaataagcattttaacggtaacggcgttatcgccagcatggagcattgcaat
gactttatgttccttggaactgaagccatctctcttggtcgtgtcggtgatgacttttgg
tgcacggatccatcaggcgatccaaacggtacgttttggctacaaggatgtcacatggtc
cactgtgcatacaacagtctctggatgggaaatttcattcagcctgattgggacatgttt
cagtccacacatccttgtgctgagttccatgctgcttctcgggccatttccggtgggccg
atttacatcagtgattgtgtgggcaagcatgattttgatctcttgaagcgtcttgttttg
cccaacggttcgattttgaggtgtgagtactatgctctcccaactcgtgaccgtctcttt
gaggatcctcttcatgatggcaaaaccatgctcaagatttggaacttgaacaagtacact
ggagttattggagcattcaactgtcaaggaggaggatggtgcagagaaaccagacgtaac
caatgtttctctgaatgcgtcaacacgttaaccgccaccacaagccctaaagacgttgaa
tggaacagtggaagcagcccaatctccattgcaaacgttgaagagtttgctttgttcttg
tctcaatccaagaagcttttgttgtctggactaaacgatgatcttgagctgactttggag
cctttcaagtttgagctgatcactgtctctcctgttgtgaccattgagggtaattcagtc
cggtttgctccgattggactggttaacatgctaaacacaagcggtgcgatccggtctttg
gtgtataatgatgaatctgttgaggtcggagtttttggtgccggagagtttagggtttat
gcatcgaaaaaacctgtgagctgcttaattgatggtgaagttgttgagtttggttatgaa
gactcaatggtgatggtgcaagtcccttggtctggtccagatggtttgtcttctattcag
tatttgttttag

DBGET integrated database retrieval system