KEGG   Arabidopsis thaliana (thale cress): AT1G01250Help
Entry
AT1G01250         CDS       T00041                                 

Definition
(RefSeq) Integrase-type DNA-binding superfamily protein
  KO
K09286  EREBP-like factor
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G01250
Transcription factors [BR:ath03000]
 Eukaryotic type
  Other transcription factors
   EREBP
    AT1G01250
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AP2
Motif
Other DBs
NCBI-GeneID: 839322
NCBI-ProteinID: NP_563624
MIPS: AT1G01250.1
TAIR: AT1G01250
Araport: AT1G01250
UniProt: Q1ECI2
Position
1
AA seq 192 aa AA seqDB search
MSPQRMKLSSPPVTNNEPTATASAVKSCGGGGKETSSSTTRHPVYHGVRKRRWGKWVSEI
REPRKKSRIWLGSFPVPEMAAKAYDVAAFCLKGRKAQLNFPEEIEDLPRPSTCTPRDIQV
AAAKAANAVKIIKMGDDDVAGIDDGDDFWEGIELPELMMSGGGWSPEPFVAGDDATWLVD
GDLYQYQFMACL
NT seq 579 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacagagaatgaagctatcatcaccaccagttaccaacaacgaaccaaccgcc
accgcttctgccgttaaatcttgcggcggaggaggtaaagaaaccagctcatcgaccacg
aggcatccagtgtaccacggagttcgcaaacgccgatggggaaaatgggtttctgagatc
agagagccccggaaaaagtctcggatttggctcggatcttttccggtgccggagatggct
gctaaggcctacgacgtggcagcgttttgtctaaaaggtagaaaagctcagctgaatttc
cctgaagaaatcgaggatctacctcgaccgtccacgtgtactcccagagatatccaagtc
gcagcggccaaagcagccaacgccgtgaagatcatcaaaatgggagatgatgacgtggca
ggaatagacgacggagatgatttctgggaaggcattgagctgcctgagcttatgatgagt
ggaggtgggtggtcgccggagccttttgttgccggagatgatgccacgtggcttgtcgac
ggagacttgtatcagtatcagttcatggcgtgtctgtga

DBGET integrated database retrieval system