KEGG   Arabidopsis thaliana (thale cress): AT1G01510Help
Entry
AT1G01510         CDS       T00041                                 

Gene name
AN
Definition
(RefSeq) NAD(P)-binding Rossmann-fold superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 839401
NCBI-ProteinID: NP_563629
MIPS: AT1G01510.1
TAIR: AT1G01510
Araport: AT1G01510
UniProt: O23702 A0A178WFD8
Position
1
AA seq 636 aa AA seqDB search
MSKIRSSATMPHRDQPSPASPHVVTLNCIEDCALEQDSLAGVAGVEYVPLSRIADGKIES
ATAVLLHSLAYLPRAAQRRLRPHQLILCLGSADRAVDSTLAADLGLRLVHVDTSRAEEIA
DTVMALILGLLRRTHLLSRHALSASGWLGSLQPLCRGMRRCRGMVLGIVGRSVSARYLAS
RSLAFKMSVLYFDVPEGDEERIRPSRFPRAARRMDTLNDLLAASDVISLHCALTNDTVQI
LNAECLQHIKPGAFLVNTGSCQLLDDCAVKQLLIDGTIAGCALDGAEGPQWMEAWVKEMP
NVLILPRSADYSEEVWMEIREKAISILHSFFLDGVIPSNTVSDEEVEESEASEEEEQSPS
KHEKLAIVESTSRQQGESTLTSTEIVRREASELKESLSPGQQHVSQNTAVKPEGRRSRSG
KKAKKRHSQQKYMQKTDGSSGLNEESTSRRDDIAMSDTEEVLSSSSRCASPEDSRSRKTP
LEVMQESSPNQLVMSSKKFIGKSSELLKDGYVVALYAKDLSGLHVSRQRTKNGGWFLDTL
SNVSKRDPAAQFIIAYRNKDTVGLRSFAAGGKLLQINRRMEFVFASHSFDVWESWSLEGS
LDECRLVNCRNSSAVLDVRVEILAMVGDDGITRWID
NT seq 1911 nt NT seq  +upstreamnt  +downstreamnt
atgagcaagatccgttcgtctgcgacaatgccacatcgcgaccagccgtcaccggcgtcg
cctcacgtcgttacactcaactgtatagaggattgtgcgctcgagcaagactccctcgcc
ggcgttgctggtgtcgaatacgtcccgctcagccgcatcgccgatggtaagatcgagtcc
gccaccgccgttctcctccattccctcgcgtatcttccacgagcagctcaacgccgactc
cgtcctcaccagctcattctctgccttggctctgctgatcgcgctgtcgattcgactctc
gccgccgacctaggtctccgacttgtccatgtagatacttcacgagccgaggaaatcgcg
gataccgtcatggcgctcatccttggactccttcgacggacgcatttactctcgcgacac
gctctatcggcgtctggttggctcggatcgcttcagcctctttgccggggaatgagacgg
tgccgtggtatggttttgggtatcgttggcagatctgtatcggctcggtatttagctagt
agaagcttggctttcaagatgagtgtgctctacttcgatgtcccagagggagatgaagaa
cgaatcaggccctcgagattcccacgtgctgctcgaagaatggatacattgaatgatctt
ctagcagcaagtgatgtcatttcgctacattgtgcattaacaaatgacacggttcagata
ctcaatgcagagtgtttgcagcatataaaacctggggcttttcttgtaaatactggaagc
tgccagctgttggatgattgtgctgtgaaacaacttctaattgatggcactatagctggc
tgcgcccttgacggtgctgaaggtccacaatggatggaagcatgggtgaaggaaatgcca
aatgtgttaattctacctcgcagtgcagattacagtgaggaagtatggatggagataagg
gagaaggctatctctatcttgcattcatttttcttagatggtgtaattccaagtaacact
gtttctgatgaggaagttgaggaaagtgaagcaagtgaagaagaagaacaatcacctagc
aaacacgagaaattagcaatagtggaatccaccagtaggcaacagggagaaagtactctc
accagcactgagatcgtacgtagagaggctagtgagttaaaagaatctctgagccctggt
cagcaacacgtttctcaaaatactgccgtaaaacctgaaggaagacgtagcagatccggt
aagaaagccaaaaagagacattcacagcaaaaatacatgcaaaaaacggatggttcctca
gggttaaatgaagaaagtacttcacgaagagatgatattgctatgagtgacacagaagaa
gtattaagttccagttctagatgtgcttctcctgaagattccagaagtaggaaaacacct
cttgaagtaatgcaagagtcttccccaaatcagcttgtaatgtcaagtaagaagttcatt
ggaaagtcaagtgagctactgaaagatggatatgtagtagccttgtatgcgaaagacctc
tcgggcctccacgtttccaggcaaagaacgaaaaacggtggctggttcctcgatactttg
tccaatgtatccaaacgagatcctgctgcacaattcattatcgcatacagaaacaaggac
actgttggtctgagatcatttgctgctggtgggaagttactgcagatcaatagaagaatg
gagtttgtgtttgctagccatagttttgacgtgtgggagagttggagtctagaaggttct
ctggacgaatgtcggcttgttaactgcaggaattcctctgcggtgttggacgttcgtgtg
gagatattggcaatggtaggagacgatggtatcacacgttggatcgattaa

DBGET integrated database retrieval system