KEGG   Arabidopsis thaliana (thale cress): AT1G02510
Entry
AT1G02510         CDS       T00041                                 

Symbol
TPK4
Name
(RefSeq) Outward rectifying potassium channel protein
  KO
K05389  potassium channel subfamily K, other eukaryote
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04040 Ion channels [BR:ath04040]
    AT1G02510 (TPK4)
Ion channels [BR:ath04040]
 Voltage-gated cation channels
  Potassium channel, two-pore domain (K2P)
   AT1G02510 (TPK4)
SSDB
Motif
Pfam: Ion_trans_2 Ion_trans IRK
Other DBs
NCBI-GeneID: 837846
NCBI-ProteinID: NP_171752
TAIR: AT1G02510
UniProt: Q9FWX6 A0A178W803
Position
1:complement(join(520687..520804,520890..521626))
AA seq 284 aa
MEEENLLNENLLHPNESSPEETQVTTVSKSKWTILVLAMILLLVYLTFGVCTYSFFRDQF
SGTETNLFVDAFYFSIVTFSTVGYGDIVPSTSTTKILTIVLVSTGVVFLDYLLNRVVSHV
LSLQENAILDRINKTRNRAIRDHIAEDGKIRLKWKLCLAFCAVGLCVGSGALFLHVFERL
DWLDSVYLSVISVTTVGYGDKTFKTVEGRGFAVFWLLLSTIAMATLFLYLAEMRIDRTTV
MKLPPSESEFIVFKLRESGRISEDDIKQIVREFENLEEVPSSGS
NT seq 855 nt   +upstreamnt  +downstreamnt
atggaagaagagaaccttctcaatgagaaccttctccatcccaacgagtcctcaccggaa
gaaactcaagtcaccaccgtatcaaaatcgaaatggaccattcttgtactagccatgatc
ctcctcttggtctacttaaccttcggggtttgcacatactcattctttcgagaccaattc
tccggaaccgagaccaatcttttcgtcgacgctttctatttctccatcgtcacattctct
acagtcggttacggggacattgtcccgtcaacttcaacgaccaagatcttgaccatcgtc
ttggtatcaaccggcgtcgtatttcttgattatctactcaaccgcgtcgtgagtcacgtt
ctaagtcttcaagaaaacgcgattcttgatcgaatcaacaagacaagaaacagagcgatt
agagatcacattgccgaagatggcaagataaggttaaagtggaaactttgtttagcgttt
tgcgccgttggtctctgcgtcggaagtggagctttgtttcttcacgttttcgagagattg
gattggttggattcggtttacttgtcggttatctccgttacgacggttggttacggagat
aaaacgtttaagacggttgaagggagaggcttcgcagtgttttggcttcttctttcaact
attgcaatggctactctgtttctttacttggctgagatgagaatcgatcgtactactgtc
atgaaattgcccccgagtgaatcagagtttattgtgttcaagcttagagaaagtgggagg
attagtgaggatgatataaagcagatcgtaagagagttcgagaatcttgaagaagtgcca
tcaagcggatcatga

DBGET integrated database retrieval system