KEGG   Arabidopsis thaliana (thale cress): AT1G03000
Entry
AT1G03000         CDS       T00041                                 
Symbol
PEX6
Name
(RefSeq) peroxin 6
  KO
K13339  peroxin-6
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G03000 (PEX6)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G03000 (PEX6)
Membrane trafficking [BR:ath04131]
 Autophagy
  Pexophagy
   Other pexophagy associated proteins
    AT1G03000 (PEX6)
SSDB
Motif
Pfam: AAA AAA_16 AAA_5 RuvB_N AAA_18 AAA_lid_3 Rad17 AAA_22 TsaE AAA_17 AAA_33 RNA_helicase DUF815 AAA_14 AAA_7 TIP49 Viral_helicase1 AAA_3 AAA_28 Mg_chelatase ATPase bpMoxR AAA_25 Sigma54_activat IstB_IS21 Parvo_NS1 PhoH AAA_24 AAA_2 Vps4_C
Other DBs
NCBI-GeneID: 839315
NCBI-ProteinID: NP_171799
TAIR: AT1G03000
UniProt: Q8RY16 A0A178WG59
Position
1:complement(687795..692660)
AA seq 941 aa
MVERRNPLVLSSTRSTLRSVLNSSQPSSADGDRVLNKDGDLLRGNARLSAGILRWRKDGE
NVSDAKLDSLDDSALVGLSTQLLKRLSINSGSLVVVKNIEIGIQRVAQVVVLDPPKTTLE
DASLTQVPVSDSLHTMLVFPTYDLMGQQLLDQEVAYLSPMLAFNLSLHISCLKSLVHRGN
GVLEKYFEAKCDEEFIGKSAEDGSKIGLDLEPVSQVPGYASHLRVSFVKIPECGTIPSLK
VNSSFEAEERQGLIDSALQKYFGTDRQLSRGDIFRIYIDWNCGSSICNPCSQRLCSESDD
YIYFKVIAMEPSNERFLRVNHSQTALVLGGTVSSGLPPDLLVYRSKVPMPLQEETVNILA
SVLSPPLCPSALASKLRVAVLLHGIPGCGKRTVVKYVARRLGLHVVEFSCHSLLASSERK
TSTALAQTFNMARRYSPTILLLRHFDVFKNLGSQDGSLGDRVGVSFEIASVIRELTEPVS
NGDSSMEEKSNSNFSENEVGKFRGHQVLLIASAESTEGISPTIRRCFSHEIRMGSLNDEQ
RSEMLSQSLQGVSQFLNISSDEFMKGLVGQTSGFLPRDLQALVADAGANLYISQESETKK
INSLSDDLHGVDIHQASQIDNSTEKLTAKEDFTKALDRSKKRNASALGAPKVPNVKWDDV
GGLEDVKTSILDTVQLPLLHKDLFSSGLRKRSGVLLYGPPGTGKTLLAKAVATECSLNFL
SVKGPELINMYIGESEKNVRDIFEKARSARPCVIFFDELDSLAPARGASGDSGGVMDRVV
SQMLAEIDGLSDSSQDLFIIGASNRPDLIDPALLRPGRFDKLLYVGVNADASYRERVLKA
LTRKFKLSEDVSLYSVAKKCPSTFTGADMYALCADAWFQAAKRKVSKSDSGDMPTEEDDP
DSVVVEYVDFIKAMDQLSPSLSITELKKYEMLRDQFQGRSS
NT seq 2826 nt   +upstreamnt  +downstreamnt
atggtggagagacggaatcctctggttctatcatccacaagaagtactctccgttcagtg
ctcaattcgtcacaacccagctctgccgacggcgaccgagttctgaataaagacggtgac
ttgttacgagggaacgctaggttgtctgcgggcattctccggtggcggaaggacggagaa
aatgtttccgatgcaaaattggattctttagatgactctgcattggttggactctccact
caattgcttaagagactatctatcaactctggttctttggttgttgtcaagaacattgag
ataggcattcaaagggttgcgcaagttgttgtacttgatcctcccaagacgacgctggaa
gatgcatctctcactcaagtacctgtttcggactctcttcatacgatgcttgtctttccc
acttatgatttgatgggccagcagttattagatcaagaggttgcttacttgtccccaatg
ttagcttttaatcttagcttgcacatatcttgcctgaaatccctcgtacatcgagggaac
ggggtcttagagaagtattttgaagctaagtgtgatgaggagtttatcggaaaatctgca
gaagatgggtcgaagattggtttggatttggaacccgtgtcccaagttccaggctatgca
tcacatctgagagtttcttttgttaaaatcccagagtgtggtaccatcccatccctgaaa
gtcaattcgtcatttgaagctgaagagcgacaagggttaatagattctgcattacagaag
tattttggaactgatagacagctatcaagaggcgatatatttcgcatttacattgactgg
aattgtggttcaagcatttgtaatccatgtagtcaaaggttgtgctccgaaagcgacgac
tatatatattttaaggttattgcgatggaaccttctaatgagaggtttcttcgagtgaat
cactcccaaaccgcccttgtccttggaggaactgtatcttctggtcttccaccagattta
ctggtgtatagatcaaaggttcctatgccattgcaggaggagacagtaaatattttggca
tcggtgctttcaccacctctctgcccatcagcactcgcctcaaaactcagggttgctgtt
ttactgcatggtataccagggtgtgggaagagaactgttgttaaatatgttgctaggagg
ttggggctgcatgtagttgaatttagctgccacagtttattagcatcatctgagaggaaa
acatctactgctttggcccagacttttaatatggcacgaaggtattcaccaacgatactt
ttgcttcgccatttcgatgtttttaaaaatctgggctctcaggatggttcactgggtgac
cgagttggtgtgtcctttgagattgcatcggttattagggaactcactgagccagtttct
aatggggacagttccatggaagaaaaatcgaatagcaatttctctgaaaatgaagttgga
aagtttaggggacatcaagtgctgctaatcgcatctgctgaaagtactgagggtatctct
ccaacaatcaggcgttgctttagccatgaaatacgtatgggttctttgaatgacgaacag
agatctgaaatgctgtctcagtccctccaaggcgtttctcaattccttaatattagctca
gatgaatttatgaaaggattggtgggacagacttctggcttccttccccgggacttgcaa
gctcttgtagctgatgctggtgccaacttatacatcagtcaagagtccgagaccaagaaa
attaactctctgtcagatgatcttcatggagttgatatacaccaggcaagccaaatagat
aacagcactgagaaattaacagctaaggaagactttaccaaagctttggatcgatcaaag
aagagaaatgcatcagcccttggtgctcctaaggttccaaatgtgaaatgggatgatgtt
ggtgggcttgaggatgtgaagacatcgatattggacacagttcaactacctctcctgcat
aaagatttattttcgtccggattgcgtaaacgttctggtgtacttctctatggccctcca
ggaacagggaaaactttactggcaaaagctgtggcgacagagtgctccttaaatttcctc
agtgtaaagggtccagaattaatcaacatgtatattggagagtcagagaaaaatgttcga
gatatatttgaaaaggcaaggtcagcgcgaccttgtgtgatcttctttgatgagcttgat
tctcttgctccagctcgaggtgcttctggtgattctggaggagtcatggatcgagtggta
tctcagatgcttgcagagatcgatggactcagcgactcttcccaggatctgtttattata
ggagcaagcaacagacctgacttgattgatccagctcttttacggcctggcagattcgac
aaacttctatatgttggagtcaacgctgatgcgtcttacagggaaagggtacttaaagca
ctgactcggaaatttaagttaagcgaagatgtatctctttattcagtagcaaagaagtgt
ccctctacattcaccggcgctgatatgtacgccttgtgtgctgatgcttggtttcaggca
gctaagcgaaaggtgtcaaaatcggattcaggggatatgcctacagaagaagatgatccc
gattcagtcgttgtagagtatgtggattttataaaggcaatggatcagctctcgccatca
ctctccataactgagcttaagaagtatgagatgcttcgagatcaatttcaaggccgttcg
agctaa

DBGET integrated database retrieval system