KEGG   Arabidopsis thaliana (thale cress): AT1G03970
Entry
AT1G03970         CDS       T00041                                 

Gene name
GBF4
Definition
(RefSeq) G-box binding factor 4
  KO
K14432  ABA responsive element binding factor
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT1G03970 (GBF4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G03970 (GBF4)
Transcription factors [BR:ath03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AREB/ABF
    AT1G03970 (GBF4)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 BLOC1S3 bZIP_Maf
Other DBs
NCBI-GeneID: 839356
NCBI-ProteinID: NP_171893
MIPS: AT1G03970.1
TAIR: AT1G03970
UniProt: P42777 A0A384LG29 Q2HIT6
Position
1
AA seq 270 aa
MASFKLMSSSNSDLSRRNSSSASSSPSIRSSHHLRPNPHADHSRISFAYGGGVNDYTFAS
DSKPFEMAIDVDRSIGDRNSVNNGKSVDDVWKEIVSGEQKTIMMKEEEPEDIMTLEDFLA
KAEMDEGASDEIDVKIPTERLNNDGSYTFDFPMQRHSSFQMVEGSMGGGVTRGKRGRVMM
EAMDKAAAQRQKRMIKNRESAARSRERKQAYQVELETLAAKLEEENEQLLKEIEESTKER
YKKLMEVLIPVDEKPRPPSRPLSRSHSLEW
NT seq 813 nt   +upstreamnt  +downstreamnt
atggcgtccttcaagttgatgtcttcttccaattccgacttgtctcgccgtaattcttct
tctgcttcatcttccccttctataagatcatcgcaccatctccgaccaaatcctcacgcc
gatcactccagaatcagtttcgcttacggcggaggagtcaacgattacactttcgcgtct
gattcaaagcccttcgagatggcgattgatgttgatcggagtatcggagatcggaacagc
gttaacaacggaaagagtgttgacgatgtttggaaagagattgtatctggagagcaaaag
acgatcatgatgaaggaagaagaaccagaagatataatgacacttgaggatttcttagcg
aaagcagaaatggacgagggagcttcagatgaaatcgatgtgaagattccaacggagaga
ctcaacaacgacggtagctatacatttgattttccgatgcagcgacacagttcgttccag
atggttgaaggatcaatgggtggaggagtaacgagaggaaagagagggagagtgatgatg
gaggcaatggataaagctgcagctcagagacagaagaggatgatcaagaaccgtgaatcc
gctgctaggtctcgagagaggaaacaggcttatcaggttgagttagagactttggctgcc
aagttagaggaggagaatgagcagcttttgaaggagattgaagagagcactaaagagaga
tacaagaagctcatggaggttctgattccggtcgatgagaaaccaaggccaccgtcgagg
cccttaagcaggagccattccttggaatggtga

DBGET integrated database retrieval system