KEGG   Arabidopsis thaliana (thale cress): AT1G04120
Entry
AT1G04120         CDS       T00041                                 

Gene name
ABCC5
Definition
(RefSeq) multidrug resistance-associated protein 5
Organism
ath  Arabidopsis thaliana (thale cress)
Motif
Pfam: ABC_membrane ABC_tran SMC_N AAA_29 MMR_HSR1 AAA_21 Dynamin_N AAA_16 DUF87 T2SSE MeaB FtsK_SpoIIIE AAA_22 AAA_23 NB-ARC
Other DBs
NCBI-GeneID: 839277
NCBI-ProteinID: NP_171908
TAIR: AT1G04120
UniProt: Q7GB25 A0A178WGC2
Position
1
AA seq 1514 aa
MDFIEISLIFREHLPLLELCSVIINLLLFLVFLFAVSARQILVCVRRGRDRLSKDDTVSA
SNLSLEREVNHVSVGFGFNLSLLCCLYVLGVQVLVLVYDGVKVRREVSDWFVLCFPASQS
LAWFVLSFLVLHLKYKSSEKLPFLVRIWWFLAFSICLCTMYVDGRRLAIEGWSRCSSHVV
ANLAVTPALGFLCFLAWRGVSGIQVTRSSSDLQEPLLVEEEAACLKVTPYSTAGLVSLIT
LSWLDPLLSAGSKRPLELKDIPLLAPRDRAKSSYKVLKSNWKRCKSENPSKPPSLARAIM
KSFWKEAACNAVFAGLNTLVSYVGPYLISYFVDYLGGKEIFPHEGYVLAGIFFTSKLIET
VTTRQWYMGVDILGMHVRSALTAMVYRKGLKLSSIAKQNHTSGEIVNYMAVDVQRIGDYS
WYLHDIWMLPMQIVLALAILYKSVGIAAVATLVATIISILVTIPLAKVQEDYQDKLMTAK
DERMRKTSECLRNMRVLKLQAWEDRYRVRLEEMREEEYGWLRKALYSQAFVTFIFWSSPI
FVAAVTFATSIFLGTQLTAGGVLSALATFRILQEPLRNFPDLVSMMAQTKVSLDRISGFL
QEEELQEDATVVIPRGLSNIAIEIKDGVFCWDPFSSRPTLSGIQMKVEKGMRVAVCGTVG
SGKSSFISCILGEIPKISGEVRICGTTGYVSQSAWIQSGNIEENILFGSPMEKTKYKNVI
QACSLKKDIELFSHGDQTIIGERGINLSGGQKQRVQLARALYQDADIYLLDDPFSALDAH
TGSDLFRDYILSALAEKTVVFVTHQVEFLPAADLILVLKEGRIIQSGKYDDLLQAGTDFK
ALVSAHHEAIEAMDIPSPSSEDSDENPIRDSLVLHNPKSDVFENDIETLAKEVQEGGSAS
DLKAIKEKKKKAKRSRKKQLVQEEERVKGKVSMKVYLSYMGAAYKGALIPLIILAQAAFQ
FLQIASNWWMAWANPQTEGDESKVDPTLLLIVYTALAFGSSVFIFVRAALVATFGLAAAQ
KLFLNMLRSVFRAPMSFFDSTPAGRILNRVSIDQSVVDLDIPFRLGGFASTTIQLCGIVA
VMTNVTWQVFLLVVPVAVACFWMQKYYMASSRELVRIVSIQKSPIIHLFGESIAGAATIR
GFGQEKRFIKRNLYLLDCFVRPFFCSIAAIEWLCLRMELLSTLVFAFCMVLLVSFPHGTI
DPSMAGLAVTYGLNLNGRLSRWILSFCKLENKIISIERIYQYSQIVGEAPAIIEDFRPPS
SWPATGTIELVDVKVRYAENLPTVLHGVSCVFPGGKKIGIVGRTGSGKSTLIQALFRLIE
PTAGKITIDNIDISQIGLHDLRSRLGIIPQDPTLFEGTIRANLDPLEEHSDDKIWEALDK
SQLGDVVRGKDLKLDSPVLENGDNWSVGQRQLVSLGRALLKQAKILVLDEATASVDTATD
NLIQKIIRTEFEDCTVCTIAHRIPTVIDSDLVLVLSDGRVAEFDTPARLLEDKSSMFLKL
VTEYSSRSTGIPEL
NT seq 4545 nt   +upstreamnt  +downstreamnt
atggattttattgagatctcgttgatctttcgagagcatttgccactactggaactatgt
tcggtcatcatcaacctcctactctttcttgtctttctatttgctgtctccgcgaggcag
attctcgtctgcgtgagaagaggcagagataggctctctaaggacgatacggtttcagct
tctaatcttagcttggaaagagaggttaaccatgttagtgttgggtttgggtttaatctg
tctttgctctgttgcttatatgtgttaggcgtccaagttttggtgttagtatatgatggg
gttaaggttagaagagaagtcagtgactggtttgttctttgctttccagcttctcagagt
ttagcttggtttgtccttagcttcttagttcttcatttgaaatacaagtcttcagagaag
ctacccttcttggtgaggatatggtggttcctggcgttttcgatttgcctctgtactatg
tatgtcgatggaagaaggctagccattgaaggttggagcagatgttcttctcatgttgtc
gccaatttagctgttacacctgctcttgggtttctctgctttctggcctggagaggcgtt
tctggtattcaagttaccagaagctcctctgatcttcaagagcctttgcttgttgaagaa
gaggcagcttgtcttaaagttactccatatagtactgctgggctagttagccttattacg
ctttcatggttggatccacttctctcggctggttcaaaaagaccgcttgagcttaaggat
ataccgcttcttgcaccaagagatagagccaaatcaagttacaaggtcttgaagtcgaat
tggaagagatgcaagtccgagaatccttcaaagcctccttctttagctcgtgcaattatg
aaatcattttggaaagaagctgcttgcaatgccgtatttgctgggttgaatactcttgtg
tcctatgtcggtccttacttgatcagctactttgttgattatcttggagggaaggagatt
ttccctcatgaaggatacgtactcgctgggatattctttacgtccaagcttatagagaca
gtcaccacccgccagtggtatatgggtgttgatatcctagggatgcatgttagatcagct
cttacagcaatggtataccgaaaaggtctcaaactttcaagtatagccaagcagaaccac
acgagcggtgaaattgtaaactacatggcagtcgatgtccagcgcataggagattactca
tggtatcttcatgatatttggatgcttccgatgcaaatagttcttgctcttgcaatccta
tataaaagcgtgggcatagctgctgtagctacattggttgctacaataatctcgattctt
gtcacgattccactcgctaaggtccaggaagactatcaagataagttgatgactgcgaaa
gatgaaagaatgaggaaaacctcagagtgtcttaggaacatgagagttctgaaattgcag
gcatgggaagatcgttatagagtgagattggaagaaatgagggaagaggagtatggttgg
cttcgcaaagccttatattctcaggcttttgttacttttatcttttggagttcccccatt
tttgtcgccgcagttacattcgctacttcgatatttctaggcactcaacttaccgctgga
ggtgttctttctgctctggcgacattcagaattcttcaggagccacttcggaactttcct
gatctggtttcaatgatggctcagacaaaggtttctcttgataggatttctgggttcttg
caggaggaagaacttcaagaagatgcaactgttgttattccacggggactttcgaatata
gccatagagattaaagatggtgtgttttgttgggaccctttttcttcaaggccgacatta
tctgggattcagatgaaagtggagaagggtatgcgtgtggctgtctgtggcacagttggc
tctggaaaatcaagttttatctcttgcatcctaggggaaatcccaaaaatctctggcgaa
gttagaatatgtggtactactggttatgtgtctcaatcggcttggattcagtctggtaac
attgaagaaaacattctatttggcagtccaatggagaaaacaaagtacaagaatgtgata
caagcatgttccctaaagaaagatatagagcttttctcacatggggaccaaactattatc
ggggagagaggtataaatctcagcggaggtcagaaacagcgtgtacaacttgcaagggca
ttatatcaagatgctgacatttatttactagacgacccttttagtgctcttgatgcacac
actggctctgatttgtttagggattatattctatctgcattggctgagaaaactgtggtt
tttgtaacgcatcaagttgagtttctccctgcagctgatctaatattggttctgaaggaa
ggcaggattattcaatcgggtaaatatgatgatctgctgcaagcaggtactgattttaag
gccttagtgtctgcccaccatgaagcaatcgaggcaatggacatcccaagtccctcctca
gaagactctgatgaaaatcctattcgcgatagtttggtcttgcataatccaaagtctgat
gtttttgaaaatgacatcgagactttggcaaaggaagtacaagagggaggatctgcttca
gatctaaaggcaatcaaagagaagaagaagaaagctaagcgttcccgcaaaaagcagctt
gttcaagaagaggaacgagtaaagggaaaagtcagcatgaaggtgtacttgtcatacatg
ggtgctgcatataaaggggctctgattcctcttattatactcgcacaagctgctttccaa
tttcttcagattgctagtaattggtggatggcttgggcaaatcctcaaactgaaggtgac
gaatctaaagtggatcctactctgcttctcatcgtttatacggctttagctttcgggagc
tctgtgttcatatttgttcgagctgctctggttgcaacttttggtcttgcagctgcacag
aaactgttcttaaatatgctcagaagtgtgttccgagcgccaatgtcattctttgattcc
actcctgcaggaagaattttgaatcgggtttctattgatcaaagtgttgtagatcttgac
attccttttagactcggtgggtttgcttcaacaacaatacaactctgtggcattgtcgct
gtaatgaccaatgttacctggcaagttttccttcttgttgttccggtagctgttgcttgc
ttttggatgcagaaatattacatggcttcttcaagagaattggttcggatagttagtatc
cagaagtctccaataattcatctttttggagaatcaattgctggtgctgccacaataaga
ggatttggccaggaaaaaagatttatcaaaaggaatctttatcttctagattgttttgtt
cgacctttcttctgcagtatcgctgctatcgaatggctttgtttacgcatggaattactt
tccacacttgtatttgctttctgtatggttttactcgtcagttttccacatggaaccatt
gatccaagcatggcaggtcttgctgtgacatatggacttaacttgaatggacgtctatca
cgatggatacttagcttttgtaagcttgaaaacaaaataatctcaatcgaaaggatttat
cagtacagtcagattgtaggagaggccccagcaattatagaagatttccgcccgccttcc
tcgtggcctgcaacgggaacaattgagctagttgatgttaaggttcgttatgctgagaat
cttccaacagtactccatggggtgagctgtgtgtttccgggtggaaaaaagattgggatt
gttgggcgaacgggaagcggaaagtcgactttgattcaagctttgtttcgattgattgag
ccaactgctggaaaaattactattgacaacattgacatttctcaaattggtcttcatgat
cttcgtagtcgccttgggattatacctcaagatcctacattatttgaaggaacaatccga
gcaaatcttgacccacttgaagaacattcagatgataaaatctgggaggcgcttgataaa
tcccagcttggagacgttgttagaggaaaagacctaaaacttgactctccagtactggaa
aatggagataactggagtgtagggcagagacagcttgtgtcacttggacgagcattactg
aaacaagccaaaatacttgttcttgatgaagcaacagcatcggttgacacagcaacagac
aatctgatccagaagataatcagaacagagtttgaagactgcacggtctgcaccattgct
caccggataccaactgttatagacagtgacctagttttggttctcagcgacggtagagta
gcagagtttgatactcctgcacggctattagaagacaaatcatcgatgttcttgaaattg
gtaacagaatactcctcaagatctactggaatccctgaattatga

DBGET integrated database retrieval system