KEGG   Arabidopsis thaliana (thale cress): AT1G04550Help
Entry
AT1G04550         CDS       T00041                                 

Gene name
IAA12
Definition
(RefSeq) AUX/IAA transcriptional regulator family protein
  KO
K14484  auxin-responsive protein IAA
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT1G04550 (IAA12)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: AUX_IAA PB1 EAR
Motif
Other DBs
NCBI-GeneID: 839495
NCBI-ProteinID: NP_171949
MIPS: AT1G04550.1
TAIR: AT1G04550
Araport: AT1G04550
UniProt: Q38830
Position
1
AA seq 239 aa AA seqDB search
MRGVSELEVGKSNLPAESELELGLGLSLGGGAWKERGRILTAKDFPSVGSKRSAESSSHQ
GASPPRSSQVVGWPPIGLHRMNSLVNNQAMKAARAEEGDGEKKVVKNDELKDVSMKVNPK
VQGLGFVKVNMDGVGIGRKVDMRAHSSYENLAQTLEEMFFGMTGTTCREKVKPLRLLDGS
SDFVLTYEDKEGDWMLVGDVPWRMFINSVKRLRIMGTSEASGLAPRRQEQKDRQRNNPV
NT seq 720 nt NT seq  +upstreamnt  +downstreamnt
atgcgtggtgtgtcagaattggaggtggggaagagtaatcttccggcggagagtgagctg
gaattgggattagggctcagcctcggtggtggcgcgtggaaagagcgtgggaggattctt
actgctaaggattttccttccgttgggtctaaacgctctgctgaatcttcctctcaccaa
ggagcttctcctcctcgttcaagtcaagtggtaggatggccaccaattgggttacacagg
atgaacagtttggttaataaccaagctatgaaggcagcaagagcggaagaaggagacggg
gagaagaaagttgtgaagaatgatgagctcaaagatgtgtcaatgaaggtgaatccgaaa
gttcagggcttagggtttgttaaggtgaatatggatggagttggtataggcagaaaagtg
gatatgagagctcattcgtcttacgaaaacttggctcagacgcttgaggaaatgttcttt
ggaatgacaggtactacttgtcgagaaaaggttaaacctttaaggcttttagatggatca
tcagactttgtactcacttatgaagataaggaaggggattggatgcttgttggagatgtt
ccatggagaatgtttatcaactcggtgaaaaggcttcggatcatgggaacctcagaagct
agtggactagctccaagacgtcaagagcagaaggatagacaaagaaacaaccctgtttag

DBGET integrated database retrieval system