KEGG   Arabidopsis thaliana (thale cress): AT1G04640Help
Entry
AT1G04640         CDS       T00041                                 

Gene name
LIP2
Definition
(RefSeq) lipoyltransferase 2
  KO
K23735  lipoyl(octanoyl) transferase 2 [EC:2.3.1.181]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00785  Lipoic acid metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00785 Lipoic acid metabolism
    AT1G04640 (LIP2)
Enzymes [BR:ath01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.181  lipoyl(octanoyl) transferase
     AT1G04640 (LIP2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: BPL_LplA_LipB
Motif
Other DBs
NCBI-GeneID: 839462
NCBI-ProteinID: NP_001030961
MIPS: AT1G04640.1
TAIR: AT1G04640
Araport: AT1G04640
UniProt: Q9SXP7 A0A178WI01
Position
1
AA seq 235 aa AA seqDB search
MRSPRTLEVWKLGTVNYLKSLKLQEKLVSERKAHQIPDTLLSLQHPPTYTLGKRRTDHNL
LIPESELTKIGAELHYTQRGGDITFHGPHQAILYPIISLRSIGFGARNYVETLERSMIEF
ASIYGVKARAGNKCETGVWVGDRKIGAIGVRISSGITSHGLALNIDPDMKYFEHIVPCGI
ADKEVTSLRRETDTLLPSEEVIHEQLVSCLAKAFSYDDVVWKEDPSLILDTQDKE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
atgagatcccctagaaccttggaggtttggaagctaggcactgtcaactatttgaaatcc
cttaaactgcaggagaaattagtttcagagagaaaagctcatcagattccagataccctc
ctctcgcttcagcatccaccaacttatacgctcggaaagcgtagaaccgatcacaatcta
cttatccctgaatctgaacttacaaaaatcggagctgaacttcattatactcaaagagga
ggagacatcaccttccatggccctcatcaagccatcttatatcccatcatttccttacgc
agcattggttttggtgctaggaactacgtggagacattggagcggtcaatgatcgagttt
gcttcgatttatggcgtgaaagctcgagcaggaaacaaatgtgagactggggtttgggtt
ggggataggaagatcggtgctattggggttaggatatcttctggaatcactagtcatggt
ttggccttaaatatagatcctgatatgaagtactttgagcacattgtgccttgtgggatt
gctgataaagaagttacatctttgcgaagagagacggatactctgcttccttcagaagaa
gtgattcatgaacagttggtttcttgtttagccaaagcgttttcttatgatgatgttgtc
tggaaggaagatccttcactcattttggacacccaagataaagaataa

DBGET integrated database retrieval system