KEGG   Arabidopsis thaliana (thale cress): AT1G05790
Entry
AT1G05790         CDS       T00041                                 
Name
(RefSeq) lipase class 3 family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: Lipase_3 Hydrolase_4 Ustilago_mating
Other DBs
NCBI-GeneID: 837088
NCBI-ProteinID: NP_001077463
TAIR: AT1G05790
UniProt: Q0WQ61
Position
1:1732802..1737583
AA seq 516 aa
MGVIEEDEVCSVARLLGDLVSYRASGTGHLEFLAGLALLQSNSQFPESYEDCMEAPAFHL
QEAAMLHKFAEAAYTGPLLDVGRNPALFLCTWICRQGILTPWSRKWRPKLDGDNWWRGHA
AAFLKFINFPAHVLRRGRICREKCKATYFVVVLHYLRCVVIAVRGTETAEDLITDGLGRA
CSLTVEDLDGLTNHVHGMDTSRKHYGHSGIVEAARDLFMQIEGDPKSGESESSGFLSSLI
GDGCECDGYSIRIVGHSLGGAIASLLGIRLRCRFPNLYVYAYGPLPCVDSDVAEACSEFV
TSIVLDNEFSSRLSYGSIRRLQVAAIKVLSQDPKADTALIFRLARRFLSASKRQRENVEE
KTSEEAIDVNNSPESQHDQIYPIWEEAEAEMQQDSEEFINPFHGMASEDNPVSQFMETGP
TKEDDDEAPEMFMPGLVIHIVPEGNNMSVPIWRGWPICDVTDGYKAYVANRESFKEIMVS
PSMFLDHLPWRCRHALQKVLESRNLFFDLTSETDIV
NT seq 1551 nt   +upstreamnt  +downstreamnt
atgggtgttattgaggaagacgaagtgtgttcagttgcaagactcttaggtgatcttgtt
tcatatcgtgcatctggcactggccatttggaatttttggcaggccttgctctgctgcaa
agtaatagccagtttcctgaatcatatgaggactgtatggaagctccagcatttcatctt
caggaggctgctatgttgcataaatttgcagaagctgcttatactgggccgctgcttgat
gttgggagaaatcctgctttatttttatgcacatggatttgtagacaagggattttaaca
ccttggagccgtaaatggcggcctaaacttgatggtgataattggtggcgaggtcatgca
gctgccttccttaagttcataaattttcctgctcatgttcttcgacgaggccgaatttgt
agggagaagtgtaaagcaacatactttgttgtagtcttacattatcttagatgtgttgta
attgctgttcgaggaactgagacggctgaagacctcataactgatggtttaggccgtgcg
tgttcactaactgttgaggacttggatgggctaacaaatcatgtacatggtatggataca
tctcgcaaacactatggacattcaggaatagtggaagctgcaagagatctatttatgcaa
atagaaggagaccccaaatctggagagtcagaatcaagtgggttcttgtcctcattgatt
ggtgatggttgtgagtgtgatggctacagcattcgcattgttgggcattctttaggaggt
gctatcgcctcattactgggaattagacttcgttgcagattccctaacctatatgtatat
gcctatggacctctcccatgtgtagattcggatgtggcagaggcatgttcagaatttgtt
acaagcattgtactcgataacgaattctcatcacgactttcatatggatcaatccgccgg
ctccaagtagcagcaatcaaagtactgtctcaagacccaaaagctgatacagcactcatt
ttcagactcgcacgccggttcttgtctgcaagcaaacgccaacgagaaaatgttgaagaa
aaaacttcagaagaagcaatagatgttaacaattcaccggaaagccaacacgatcaaata
tacccaatatgggaagaagctgaagcagaaatgcagcaagatagcgaagagttcataaac
ccatttcacggtatggcctcagaggataatcccgtgtctcagtttatggaaacaggacca
acaaaagaagacgatgatgaagctccagagatgttcatgcccggtttagtcattcatatt
gtacccgaaggaaacaacatgagtgtgccgatatggcgaggatggccaatctgtgatgtg
acggatggttacaaagcttatgttgcaaacagagagagcttcaaagaaattatggtttct
ccatcaatgttccttgatcatcttccttggagatgtagacacgcgctgcagaaggttcta
gaatctcggaatctcttcttcgatctgacaagtgagactgatatagtataa

DBGET integrated database retrieval system