KEGG   Arabidopsis thaliana (thale cress): AT1G06680
Entry
AT1G06680         CDS       T00041                                 
Symbol
PSBP-1
Name
(RefSeq) photosystem II subunit P-1
  KO
K02717  photosystem II oxygen-evolving enhancer protein 2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00195  Photosynthesis
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00195 Photosynthesis
    AT1G06680 (PSBP-1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:ath00194]
    AT1G06680 (PSBP-1)
Photosynthesis proteins [BR:ath00194]
 Photosystem and electron transport system
  Photosystem II (P680 chlorophyll a) [OT]
   Other common subunits
    AT1G06680 (PSBP-1)
SSDB
Motif
Pfam: PsbP PsbP_C PsbQ
Other DBs
NCBI-GeneID: 837178
NCBI-ProteinID: NP_172153
TAIR: AT1G06680
UniProt: Q42029 A0A178W7Q1
Position
1:2047634..2049439
AA seq 263 aa
MAYSACFLHQSALASSAARSSSSSSSQRHVSLSKPVQIICKAQQSHEDDNSAVSRRLALT
LLVGAAAVGSKVSPADAAYGEAANVFGKPKTNTDFLPYNGDGFKVQVPAKWNPSKEIEYP
GQVLRFEDNFDATSNLNVMVTPTDKKSITDYGSPEEFLSQVNYLLGKQAYFGETASEGGF
DNNAVATANILESSSQEVGGKPYYYLSVLTRTADGDEGGKHQLITATVNGGKLYICKAQA
GDKRWFKGARKFVESAATSFSVA
NT seq 792 nt   +upstreamnt  +downstreamnt
atggcgtacagtgcgtgtttcctacaccagagcgcattggcttcatcagccgcacgatca
tcatcttcctcctcatcccagcgtcacgtgtcgctctccaaacctgttcagatcatctgt
aaagctcaacagtctcatgaagacgataactccgccgtctcccgccgtcttgctctcact
ctcctcgtcggcgccgctgctgttggttccaaagtatctcctgctgatgccgcctacggt
gaagctgcaaacgtgtttgggaagccaaagacgaacacagacttcttgccatacaatgga
gatgggttcaaagtgcaggttccagcaaaatggaacccaagcaaagagattgagtatcca
ggacaagtccttaggttcgaagacaacttcgatgctactagcaatctcaatgtcatggtc
actcctaccgacaagaagtccatcactgattacggttctcccgaagagttcctctctcag
gttaattacctcctagggaaacaagcttacttcggtgagactgcctctgagggaggcttt
gacaacaatgcagtggcaacagcaaacattctggagtcatcatctcaggaagttggtggg
aaaccctactattacttgtctgtgttgacaagaacggctgatggagacgaaggtgggaag
catcagctgatcacagcaaccgtgaatggagggaagctttacatctgcaaagcacaagct
ggagacaagaggtggttcaagggagccaggaaatttgtcgagagcgcagccacttctttc
agtgttgcttga

DBGET integrated database retrieval system