KEGG   Arabidopsis thaliana (thale cress): AT1G08700Help
Entry
AT1G08700         CDS       T00041                                 

Gene name
PS1
Definition
(RefSeq) Presenilin-1
  KO
K04505  presenilin 1 [EC:3.4.23.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases [BR:ath01002]
    AT1G08700 (PS1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.23  Aspartic endopeptidases
    3.4.23.-  
     AT1G08700 (PS1)
Peptidases [BR:ath01002]
 Aspartic Peptidases
  Family A22: presenilin family
   AT1G08700 (PS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Presenilin DUF1120
Motif
Other DBs
NCBI-GeneID: 837391
NCBI-ProteinID: NP_172346
MIPS: AT1G08700.1
TAIR: AT1G08700
Araport: AT1G08700
UniProt: O64668 A0A384LEN8 Q0V7S4
Position
1
AA seq 453 aa AA seqDB search
MESSILDSLGVEIIGVMAPVSICMFLVVLLTYSLSVTSDPQIRSAANLIYIENPSDSTTV
KLEGSLANAIVFVVLIAAVTFILVLLFYYNFTNFLKHYMRFSAFFVLGTMGGAIFLSIIQ
HFSIPVDSITCFILLFNFTILGTLSVFAGGIPIVLRQCYMVVMGIVVAAWFTKLPEWTTW
FILVALALYDLVAVLAPGGPLKLLVELASSRDEELPAMVYEARPTVSSGNQRRNRGSSLR
ALVGGGGVSDSGSVELQAVRNHDVNQLGRENSHNMDYNAIAVRDIDNVDDGIGNGSRGGL
ERSPLVGSPSASEHSTSVGTRGNMEDRESVMDEEMSPLVELMGWGDNREEARGLEESDNV
VDISNRGIKLGLGDFIFYSVLVGRAAMYDLMTVYACYLAIISGLGCTLILLSVYNRALPA
LPISIMLGVVFYFLTRLLMEPFVVGVTTNLMMF
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atggagtctagtatcctcgattccctcggagttgagattatcggcgtgatggctcccgtc
tccatctgcatgttcctcgtcgtccttctcacctactctctctctgtcacttctgaccct
cagatccgtagcgccgctaacctcatttacatcgagaatccctccgactccaccaccgtc
aagctcgaaggtagtctcgccaacgccatcgtcttcgtcgtcctcattgccgccgtcact
ttcatccttgttctcctcttctactataacttcaccaatttccttaagcattacatgcgt
ttctctgccttctttgtcttaggtacgatgggaggtgcaattttcctatcgataatccag
catttctcaattcctgttgattccatcacctgcttcatattgcttttcaatttcacgatc
ttggggactttgtctgtgtttgctggtgggataccaattgtgcttagacagtgttatatg
gttgttatggggatagttgttgcagcttggttcactaagttacctgagtggactacatgg
tttatcttggtggctttagctttgtatgacttggttgctgttttggcacctggtgggcca
cttaagttgttggtagagctggcttcgagccgcgatgaggaacttcctgctatggtttat
gaagctaggccgactgtttcatcaggcaaccaaaggagaaaccgtggctcgagtttaagg
gctttggttggtggtgggggggtttcagattctggatcagttgagctgcaagcagttcgg
aatcatgatgtaaaccaacttggaagggaaaattctcataatatggattataatgctatt
gcggtgagggatatagacaatgtagatgatggtattggtaacggaagcagaggtggactt
gagaggtcacctctagttggaagtcccagtgcgtcagagcactcaacctcagtaggaacc
agaggaaatatggaagacagagaaagtgttatggatgaagaaatgtctccactagttgag
ttgatgggttggggagataatagggaagaagcaagaggtttggaggagtcggataacgtt
gtggacatttcaaatagaggcataaaacttggtcttggagactttattttctacagtgtt
cttgttggtagggcagcaatgtatgatctgatgactgtgtatgcctgttaccttgcgatc
atctccggacttgggtgcactcttattttgttatctgtgtacaaccgagctctgcctgcc
cttcccatatccatcatgttgggtgttgttttttacttcttgacgcgactattgatggag
ccctttgttgttggggtgacaacaaacttgatgatgttctga

DBGET integrated database retrieval system