KEGG   Arabidopsis thaliana (thale cress): AT1G09180Help
Entry
AT1G09180         CDS       T00041                                 

Gene name
SARA1A
Definition
(RefSeq) secretion-associated RAS super family 1
  KO
K07953  GTP-binding protein SAR1 [EC:3.6.5.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04141  Protein processing in endoplasmic reticulum
Module
ath_M00404  COPII complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    AT1G09180 (SARA1A)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G09180 (SARA1A)
  09183 Protein families: signaling and cellular processes
   04031 GTP-binding proteins [BR:ath04031]
    AT1G09180 (SARA1A)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.5  Acting on GTP to facilitate cellular and subcellular movement
    3.6.5.-  
     AT1G09180 (SARA1A)
Membrane trafficking [BR:ath04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   Coat protein complex II (COP-II)
    AT1G09180 (SARA1A)
GTP-binding proteins [BR:ath04031]
 Small (Monomeric) G-proteins
  Arf/Sar Family
   Sar
    AT1G09180 (SARA1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arf G-alpha Roc SRPRB MMR_HSR1 Ras Gtr1_RagA PduV-EutP
Motif
Other DBs
NCBI-GeneID: 837438
NCBI-ProteinID: NP_172390
MIPS: AT1G09180.1
TAIR: AT1G09180
Araport: AT1G09180
UniProt: O80489
Position
1
AA seq 193 aa AA seqDB search
MFLFDWFYGILASLGLCKKEAKILFLGLDNAGKTTLLHMLKDERLVQHQPTQHPTSEELS
IGKINFKAFDLGGHQIARRVWKDCYAKVDAVVYLVDAYDRDRFVESKRELDALLSDEALA
NVPCLILGNKIDIPYASSEDELRYYLGLTNFTTGKGIVNLEDSGVRPLEVFMCSIVRKMG
YGEGFKWLSQYIK
NT seq 582 nt NT seq  +upstreamnt  +downstreamnt
atgtttttattcgattggttctatggaatcttggcctcgttagggttgtgcaaaaaagag
gcgaaaatcttgtttttaggcctcgacaatgccggaaaaactactttgcttcacatgctc
aaagatgagagattagttcagcaccagccaacacagcatcccacgtctgaggaacttagc
attggcaaaatcaacttcaaggcctttgatttgggtggccatcagattgctcgtagggtt
tggaaagactgctatgccaaggttgatgctgttgtctacctagtggatgcttacgacagg
gatagatttgtggagtcgaaaagagagctagacgctcttttatcagatgaagccttagca
aatgttccctgtcttattcttggcaacaagattgatataccttatgcatcctcagaagat
gagcttaggtattacttaggtctcaccaatttcactaccggtaaaggcatagtgaatctt
gaagactctggtgttcgtccccttgaggtcttcatgtgcagcatcgtccgcaaaatgggt
tatggcgagggttttaaatggctatctcagtatatcaagtag

DBGET integrated database retrieval system