KEGG   Arabidopsis thaliana (thale cress): AT1G09410Help
Entry
AT1G09410         CDS       T00041                                 

Definition
(RefSeq) pentatricopeptide (PPR) repeat-containing protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 PPR_1 DYW_deaminase PPR_3 PPR_long TPR_17 AEP1
Motif
Other DBs
NCBI-GeneID: 837463
NCBI-ProteinID: NP_172412
MIPS: AT1G09410.1
TAIR: AT1G09410
Araport: AT1G09410
UniProt: Q56XI1 A0A178WG80
Position
1
AA seq 705 aa AA seqDB search
MKSQILLRRTYSTTIPPPTANVRITHLSRIGKIHEARKLFDSCDSKSISSWNSMVAGYFA
NLMPRDARKLFDEMPDRNIISWNGLVSGYMKNGEIDEARKVFDLMPERNVVSWTALVKGY
VHNGKVDVAESLFWKMPEKNKVSWTVMLIGFLQDGRIDDACKLYEMIPDKDNIARTSMIH
GLCKEGRVDEAREIFDEMSERSVITWTTMVTGYGQNNRVDDARKIFDVMPEKTEVSWTSM
LMGYVQNGRIEDAEELFEVMPVKPVIACNAMISGLGQKGEIAKARRVFDSMKERNDASWQ
TVIKIHERNGFELEALDLFILMQKQGVRPTFPTLISILSVCASLASLHHGKQVHAQLVRC
QFDVDVYVASVLMTMYIKCGELVKSKLIFDRFPSKDIIMWNSIISGYASHGLGEEALKVF
CEMPLSGSTKPNEVTFVATLSACSYAGMVEEGLKIYESMESVFGVKPITAHYACMVDMLG
RAGRFNEAMEMIDSMTVEPDAAVWGSLLGACRTHSQLDVAEFCAKKLIEIEPENSGTYIL
LSNMYASQGRWADVAELRKLMKTRLVRKSPGCSWTEVENKVHAFTRGGINSHPEQESILK
ILDELDGLLREAGYNPDCSYALHDVDEEEKVNSLKYHSERLAVAYALLKLSEGIPIRVMK
NLRVCSDCHTAIKIISKVKEREIILRDANRFHHFRNGECSCKDYW
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcacagatactcctacgtcgaacgtatagcacaaccatccctcctcccacagca
aatgttagaatcactcatctctctcgtatcggcaagattcatgaagctcggaagcttttc
gattcatgtgactcgaaatcaatctcttcctggaactctatggttgctgggtactttgcg
aatctaatgccccgagatgcacggaaactgttcgatgaaatgcctgacagaaacatcatc
tcttggaatggtttggtgtccgggtatatgaagaacggggagattgacgaagctaggaaa
gtgtttgatttaatgcctgagaggaatgttgtctcatggacggcgttggtgaaagggtat
gtgcacaatggtaaggttgatgtggcagagtcgttgttttggaaaatgcctgagaagaat
aaggtttcttggactgtgatgcttattgggtttttgcaagatgggcgaatcgatgatgcg
tgtaagctgtatgaaatgataccggataaagataatattgcaaggactagtatgattcat
ggattgtgcaaagaaggaagagtggatgaggcaagagagatttttgatgagatgtcagag
agaagtgtgattacttggactacaatggtcacaggatatgggcagaacaatcgtgtggat
gatgctaggaagatttttgatgtgatgccagagaaaactgaagtttcatggacttccatg
cttatgggctatgtacagaatgggcgaattgaggatgctgaagaactttttgaagttatg
ccagtgaagccagttattgcgtgtaatgctatgatttccgggcttggacagaaaggagag
atagcaaaagcaagaagggtttttgattcaatgaaggagagaaatgatgcatcttggcaa
acggtgatcaaaattcacgaaagaaacggttttgaattggaggctcttgatttatttatt
ctgatgcagaaacagggagttagacccacttttccaacattgataagcattctttcggtc
tgcgccagcttagcaagcctccaccatggtaaacaggtccatgctcagttggttagatgt
caatttgatgttgatgtgtatgttgcgtctgttttaatgacaatgtacattaaatgcggc
gagcttgtgaagtctaaactaatatttgacaggtttccttcaaaggacattatcatgtgg
aattcaatcatatctggttatgcctcacacggtcttggagaggaagcattaaaggttttc
tgtgagatgcctttgtctggtagtactaagcctaacgaagtcaccttcgttgcaactctc
tcagcatgtagttacgctgggatggttgaggaagggcttaagatctatgaatctatggaa
tcagtttttggggttaagccaatcaccgcgcattatgcttgcatggtagatatgcttggg
cgtgcaggacggtttaatgaggcaatggaaatgattgatagtatgactgtcgaaccagat
gctgcagtttggggttctctattaggagcgtgcagaactcactcgcagctggatgtggca
gaattttgtgcgaagaaactcatagagattgaaccggagaattctgggacttacatcttg
ctctccaacatgtatgcatctcaaggtaggtgggctgacgttgcagaactgagaaaactt
atgaagactaggttggtaagaaaatcaccaggttgtagctggactgaagtcgagaacaag
gtgcatgcattcactcgtgggggtattaatagccatcccgagcaggaatctattttgaag
atactggatgaattggatgggttattgagagaagccgggtataatcctgattgcagctat
gcattgcacgatgtagacgaggaagagaaagtcaatagcctgaaatatcatagcgagaga
ctagcggtagcttatgctcttttaaagctatctgaaggaatacccatccgagtcatgaag
aaccttagagtttgtagtgattgccacacagcaataaaaataatctctaaggtgaaagag
agggagatcattctaagagatgcaaacagattccatcacttcagaaacggagagtgttcc
tgtaaagattactggtga

DBGET integrated database retrieval system