KEGG   Arabidopsis thaliana (thale cress): AT1G09795
Entry
AT1G09795         CDS       T00041                                 
Symbol
ATP-PRT2
Name
(RefSeq) ATP phosphoribosyl transferase 2
  KO
K00765  ATP phosphoribosyltransferase [EC:2.4.2.17]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00340  Histidine metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01230  Biosynthesis of amino acids
Module
ath_M00026  Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00340 Histidine metabolism
    AT1G09795 (ATP-PRT2)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.17  ATP phosphoribosyltransferase
     AT1G09795 (ATP-PRT2)
SSDB
Motif
Pfam: HisG HisG_C AtuA
Other DBs
NCBI-GeneID: 837509
NCBI-ProteinID: NP_563853
TAIR: AT1G09795
UniProt: Q8GSJ1
Position
1:3173534..3176910
AA seq 413 aa
MPISIPLNATLQYSSPSSSSSSSSLVPSSPLFSPIPSTTVSLTGIRQRCLRMVTSCVSNA
QKSVLNGATDSVSVVGREQIRLGLPSKGRMAADSLDLLKDCQLFVKQVNPRQYVAQIPQL
PNTEVWFQRPKDIVRKLLSGDLDLGIVGLDIVGEFGQGNEDLIIVHEALNFGDCHLSLAI
PNYGIFENIKSLKELAQMPQWTEERPLRVATGFTYLGPKFMKDNGIKHVTFSTADGALEA
APAMGIADAILDLVSSGTTLKENNLKEIEGGVVLESQAALVASRRALTERKGALETVHEI
LERLEAHLKANGQFTVVANMRGTDAEEVAERVKTQPSLSGLQGPTISPVYCKRDGKVTIE
YYAIVICVPKKALYESVQQLRAVGGSGVLVSPVTYIFHEETPRWSQLLSNLGL
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgccaatctcaattccccttaacgccactctacaatactcgtctccttcttcttcttct
tcttcttcttctctcgtaccttcttcccctcttttctctccgattccttcaaccactgtt
tcccttaccggaattcgccagcgatgcctcaggatggtcacttcttgcgtctccaacgct
cagaaatccgtcctgaatggtgccaccgattccgtctctgtcgtcgggcgggagcagatt
cgtcttggtcttcctagcaaaggacgcatggccgccgattcgctggatcttctcaaggat
tgccaattgtttgtcaaacaagtcaatccacgacaatatgttgctcaaattcctcagtta
ccaaatactgaagtttggtttcaacgaccaaaagacattgtcagaaagttgctatcagga
gatctggatctaggcatcgttggtcttgacatagttggtgaatttggtcagggaaatgaa
gatcttatcattgtccacgaagctctcaactttggagattgtcatctctcccttgccata
cccaattatggaatatttgagaatataaaatctctgaaggagctagcacaaatgcctcaa
tggaccgaggaaagacctttacgagttgctacaggattcacttatctaggccccaaattt
atgaaagacaacggtataaagcatgtgactttctcaactgcagatggagccctagaggca
gcgcctgcgatggggatagctgatgccattttagaccttgtgagcagtgggacaaccctt
aaagagaacaacttaaaagaaattgaaggaggggttgtgctggaaagtcaggctgcacta
gtggcgagtagaagggcattgactgagagaaaaggagcactagaaacagtgcatgagatt
ctcgagagattagaggctcatttgaaggcaaatggtcaattcactgtggttgcaaacatg
agaggaacggatgctgaagaagtggctgaacgtgtgaaaacccaaccatcactatcagga
ttgcagggaccaacaataagtccagtttattgtaaacgagatggaaaagtaacaattgag
tactatgccattgtgatatgtgtaccaaaaaaagcgctttatgagtctgtgcagcaactg
agagcggtgggaggaagtggggtactagtttctcctgtaacatacatttttcatgaggag
actcccagatggagtcagcttctgagtaacctcggcctttga

DBGET integrated database retrieval system