KEGG   Arabidopsis thaliana (thale cress): AT1G09870Help
Entry
AT1G09870         CDS       T00041                                 

Definition
(RefSeq) histidine acid phosphatase family protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00010  Glycolysis / Gluconeogenesis
ath00562  Inositol phosphate metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    AT1G09870
   00562 Inositol phosphate metabolism
    AT1G09870
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     AT1G09870
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     AT1G09870
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 837519
NCBI-ProteinID: NP_563856
MIPS: AT1G09870.1
TAIR: AT1G09870
Araport: AT1G09870
UniProt: Q941B2 A0A178W2B9
Position
1
AA seq 487 aa AA seqDB search
MATKTVWIILLCLFVVSQADQGFDVRHHLSTVTRYSTSKDVTQNLIEGSNVPSECTPIHL
NLVARHGTRSPTKKRLRELESLAGRFKELVRDAEARKLPSDKIPGWLGQWKSPWEGKVKG
GELIRQGEDELYQLGIRVRERFPSLFEEDYHPDVYTIRATQIPRASASAVAFGMGLFSEK
GNLGPGRNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKEPAVDKLKEPVLNKITASVA
KRYDLKFTKQDISSLWFLCKQEASLLNVTNQSCELFTPSEVALLEWTDDLEVFLLKGYGN
SLNYKMGVPLLEDVLHSMEEAIKAREEKLPPGSYEKARLRFAHAETIVPFSCLLGLFLDG
SEFEKIQKEKPLELPPQPPKTRDFRGSTMAPFGGNNILVLYSCPAESSPKYFVQVLHNEH
PIAVPGCDGKDFCPLEDFKAKVVTPHLKHAFDNLCNADLNDLKQKPASSKLSILSSWLFG
SSHDTEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagactgtttggatcatactgttgtgtctatttgttgtttcccaggcagat
cagggtttcgatgttcgtcatcacctctccaccgtcaccagatactctacttcgaaagat
gttacccaaaatttgattgaagggtcgaatgttcctagtgagtgtacacctatccacctt
aaccttgtggctaggcatggaactcgttctccgaccaagaaacgattgcgggaattggaa
agtttggctggtaggtttaaggaactggtaagagatgcagaagctaggaaattgccttca
gacaaaattcctggatggttgggacaatggaaatctccttgggaaggaaaagtgaaaggt
ggggagctgatcaggcaaggggaggatgagttataccaactgggaattcgggttcgggaa
cggtttcctagtttgtttgaagaggattaccatcctgatgtctatacaataagagctacg
cagattcctagggcatctgcaagtgctgtagcatttggaatggggttattcagtgagaaa
ggaaatctgggaccaggccgtaatagagcattcgctgtcactagcgaaaaccgtgccagt
gatacaaagttgagattttttgaatgttgtcaaaactacaagagctatagaaaagctaaa
gagcctgctgtggataagctcaaggaacctgttctgaataaaattacagcttccgttgca
aagagatatgatttaaaattcacgaaacaggacatttcttctctctggtttctgtgcaag
caggaagcatcattgcttaatgtaactaatcaaagttgtgaacttttcacgccatcagag
gttgctttgctggaatggacagatgatttggaagtgtttctcctcaaaggttatggaaat
tccttgaattacaaaatgggagttccacttctagaagatgttttgcattcaatggaagaa
gctatcaaggcccgggaagaaaagctcccacctggaagttacgaaaaagcaaggcttagg
tttgcacatgccgaaacaatagttcccttttcttgtcttcttgggcttttccttgatgga
tctgagtttgagaaaatacagaaggagaaacctttggaactccctccacagcctcccaaa
accagggattttagaggcagcaccatggctccttttggtgggaacaacattcttgtccta
tacagttgtcccgcagaatcctctcccaaatacttcgttcaggttctgcacaatgagcat
cctattgcagtgccaggttgtgatggaaaagatttctgtcctcttgaagatttcaaggcc
aaagtggtaactcctcatctaaagcatgcttttgacaacctttgcaatgctgatctaaat
gacctgaaacagaagcctgcatcaagtaagttatctatactgtcaagttggctgtttggg
tcaagccacgataccgagctctag

DBGET integrated database retrieval system