KEGG   Arabidopsis thaliana (thale cress): AT1G09960
Entry
AT1G09960         CDS       T00041                                 

Gene name
SUT4
Definition
(RefSeq) sucrose transporter 4
  KO
K15378  solute carrier family 45, member 1/2/4
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G09960 (SUT4)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC45: H+/sugar cotransporter
   AT1G09960 (SUT4)
SSDB
Motif
Pfam: MFS_2 PUCC
Other DBs
NCBI-GeneID: 837530
NCBI-ProteinID: NP_172467
MIPS: AT1G09960.1
TAIR: AT1G09960
UniProt: Q9FE59 A0A5S9TJ78
Position
1
AA seq 510 aa
MATSDQDRRHRVTRNRPPIARPSTSSSRPVVSPPRSKVSKRVLLRVASVACGIQFGWALQ
LSLLTPYVQELGIPHAWASVIWLCGPLSGLFVQPLVGHSSDRCTSKYGRRRPFIVAGAVA
ISISVMVIGHAADIGWAFGDREGKIKPRAIVAFVLGFWILDVANNMTQGPCRALLADLTE
NDNRRTRVANGYFSLFMAVGNVLGYATGSYNGWYKIFTFTKTVACNVECANLKSAFYIDV
VFIAITTILSVSAAHEVPLASLASEAHGQTSGTDEAFLSEIFGTFRYFPGNVWIILLVTA
LTWIGWFPFILFDTDWMGREIYGGEPNIGTSYSAGVSMGALGLMLNSVFLGITSVLMEKL
CRKWGAGFVWGISNILMAICFLGMIITSFVASHLGYIGHEQPPASIVFAAVLIFTILGIP
LAITYSVPYALISIRIESLGLGQGLSLGVLNLAIVIPQVIVSVGSGPWDQLFGGGNSPAL
AVGAATGFIGGIVAILALPRTRIQKPIPLP
NT seq 1533 nt   +upstreamnt  +downstreamnt
atggctacttccgatcaagatcgccgtcacagagtcactcgcaaccgtccaccaatagct
cgaccctctacttcttcatctcgtcccgttgtatctcctcctagatcaaaagtttcgaag
cgtgtgcttctccgtgtagcttccgtcgcatgcgggattcaattcggatgggctcttcag
ctttctctcctcacaccttacgttcaagagctggggatcccacacgcttgggctagtgtg
atttggctttgcggtcctctctctggtttgttcgtgcaaccgctcgttgggcatagtagc
gataggtgtactagtaagtacggtcgtcggagaccgtttattgtcgccggagctgtggcg
atttctatctctgttatggttattggtcatgcggcggatattggatgggcatttggggat
agagaagggaagattaagccgagggcgattgttgcttttgttttagggttttggattctt
gatgttgctaataatatgactcaaggtccttgtagagctctccttgctgatcttactgag
aatgataatcgcagaacccgagttgcaaatggctacttctctctctttatggctgttggc
aatgttcttggctatgctactggatcatacaatggttggtacaagatcttcacttttacg
aagacagttgcatgtaatgtggaatgtgccaatctcaagtctgccttctacatagatgtt
gtctttattgcaataactacgatcctaagcgtctcagcggctcatgaggtgccacttgct
tcattggcttctgaagcacatgggcaaaccagtggaacagacgaagcttttctttctgag
atatttggaactttcagatattttccaggaaatgtttggataatcttgcttgttacagca
ttgacatggattggttggtttccatttattctgtttgatactgattggatgggtcgagag
atctatggcggtgaaccgaacatagggacttcatatagtgctggggtcagtatgggtgca
cttggtttgatgttgaattctgtttttcttggaatcacttctgtgctcatggagaaactt
tgcagaaagtggggggctggttttgtttggggaatatcaaatatcttaatggctatttgc
tttcttggaatgataatcacctcatttgttgcgtctcaccttggctacattggccatgaa
caacctcctgccagcatcgtgtttgctgctgtgttaatctttacaattctgggcattcca
ttggcgataacttacagcgtcccatatgcgttgatttccatacgtattgaatccctgggc
ttaggtcaaggcttatctttgggtgtgctaaatttggcgatagtcatcccacaggtaatt
gtgtctgttggcagtggcccatgggatcaactgtttggaggtgggaattcaccggcactt
gcagtaggagcagctacaggcttcattggcggaattgtagctatcttggctcttccacgg
acaaggattcagaagcccatccctctcccatga

DBGET integrated database retrieval system