KEGG   Arabidopsis thaliana (thale cress): AT1G11720
Entry
AT1G11720         CDS       T00041                                 
Symbol
SS3
Name
(RefSeq) starch synthase 3
  KO
K00703  starch synthase [EC:2.4.1.21]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00854  Glycogen biosynthesis, glucose-1P => glycogen/starch
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    AT1G11720 (SS3)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:ath01003]
    AT1G11720 (SS3)
Enzymes [BR:ath01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.21  starch synthase (glycosyl-transferring)
     AT1G11720 (SS3)
Glycosyltransferases [BR:ath01003]
 Polysaccharide
  Storage polysaccharide
   AT1G11720 (SS3)
SSDB
Motif
Pfam: Glyco_transf_5 CBM53 Glyco_transf_4 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_4_4
Other DBs
NCBI-GeneID: 837716
NCBI-ProteinID: NP_172637
TAIR: AT1G11720
UniProt: F4IAG2
Position
1:3951366..3957044
AA seq 1042 aa
MISYFLNQDFSRKKQGRMAASGPKSSGPRGFGRRTTVGSAQKRTQKKNGEKDSNATSTAT
NEVSGISKLPAAKVDVQKQSSVVLNERNVLDRSDIEDGSDRLDKKTTDDDDLLEQKLKLE
RENLRRKEIETLAAENLARGDRMFVYPVIVKPDEDIEVFLNRNLSTLNNEPDVLIMGAFN
EWRWKSFTRRLEKTWIHEDWLSCLLHIPKEAYKMDFVFFNGQSVYDNNDSKDFCVEIKGG
MDKVDFENFLLEEKLREQEKLAKEEAERERQKEEKRRIEAQKAAIEADRAQAKAETQKRR
ELLQPAIKKAVVSAENVWYIEPSDFKAEDTVKLYYNKRSGPLTNSKELWLHGGFNNWVDG
LSIVVKLVNAELKDVDPKSGNWWFAEVVVPGGALVIDWVFADGPPKGAFLYDNNGYQDFH
ALVPQKLPEELYWLEEENMIFRKLQEDRRLKEEVMRAKMEKTARLKAETKERTLKKFLLS
QKDVVYTEPLEIQAGNPVTVLYNPANTVLNGKPEVWFRGSFNRWTHRLGPLPPQKMEATD
DESSHVKTTAKVPLDAYMMDFVFSEKEDGGIFDNKNGLDYHLPVVGGISKEPPLHIVHIA
VEMAPIAKVGGLGDVVTSLSRAVQELNHNVDIVFPKYDCIKHNFVKDLQFNRSYHWGGTE
IKVWHGKVEGLSVYFLDPQNGLFQRGCVYGCADDAGRFGFFCHAALEFLLQGGFHPDILH
CHDWSSAPVSWLFKDHYTQYGLIKTRIVFTIHNLEFGANAIGKAMTFADKATTVSPTYAK
EVAGNSVISAHLYKFHGIINGIDPDIWDPYNDNFIPVPYTSENVVEGKRAAKEELQNRLG
LKSADFPVVGIITRLTHQKGIHLIKHAIWRTLERNGQVVLLGSAPDPRIQNDFVNLANQL
HSSHGDRARLVLTYDEPLSHLIYAGADFILVPSIFEPCGLTQLIAMRYGAVPVVRKTGGL
FDTVFDVDHDKERAQAQVLEPNGFSFDGADAPGVDYALNRAISAWYDGREWFNSLCKTVM
EQDWSWNRPALEYLELYHSARK
NT seq 3129 nt   +upstreamnt  +downstreamnt
atgatttcttattttcttaaccaagacttttcaaggaagaagcaaggaagaatggctgct
tcaggaccaaaaagctcaggtcccagaggttttgggcgacgaacaacagtaggaagtgct
cagaaaagaactcagaagaagaatggtgaaaaagatagtaatgccacttctacagcaaca
aacgaggtttcagggattagtaagttgcccgcagctaaagtggatgtacagaagcaaagc
tctgttgttttgaatgagagaaatgtgttagataggtcggatattgaggatggaagtgat
cgtttggacaagaaaacaaccgatgatgatgatttgttagaacaaaagttaaaacttgaa
agagagaatcttcgtaggaaggaaatagaaacgcttgcagcggaaaatttggcgagaggt
gatagaatgtttgtgtatcccgttattgtgaaacctgatgaagacatagaagtgtttctc
aacaggaatctgtcgactctgaataacgaacccgatgttttgatcatgggggcgtttaac
gaatggagatggaagtctttcacaaggagattggaaaagacctggatccatgaagattgg
ttgtcatgtctccttcatatccccaaagaagcgtataagatggacttcgtgtttttcaat
gggcaaagtgtatatgacaacaatgactcaaaagatttttgtgtagagataaaaggtggg
atggataaagttgactttgagaattttcttctagaagagaaactgcgagagcaagagaag
ttagccaaggaagaagctgagagggagaggcaaaaagaagagaagagaagaatcgaagct
caaaaggctgcaattgaagctgatagagcacaagcaaaggcggagactcagaagagacgt
gaattgcttcaaccggctattaagaaagctgtagtctcggctgagaatgtttggtacatt
gagccgagtgatttcaaggctgaagatacagtgaagctatattacaataaaaggtcaggt
cctctgactaattccaaagaactgtggttacatggagggtttaataattgggttgatgga
ttatctatcgttgtaaagcttgttaatgctgagttaaaggatgttgatccaaagagcgga
aattggtggttcgctgaagttgtagtgcctggcggtgcactagtcattgactgggtcttt
gctgatggaccacctaaaggagcgtttctgtatgacaataatggttaccaagacttccac
gcacttgttcctcaaaaacttcctgaagaactttactggttagaggaagaaaatatgatt
tttagaaaacttcaggaggataggcggttaaaagaggaagttatgcgtgccaagatggaa
aaaacagctcgcttgaaagctgaaactaaggaaagaacactgaaaaagtttctgctatcc
cagaaagacgtggtttacaccgagcctctagagattcaagcaggaaaccctgtgactgta
ttgtacaatcctgcaaacacggttttgaatggaaaacctgaagtttggtttagaggctct
tttaatcgttggactcaccgcttgggccctttgccacctcagaaaatggaagcaacagat
gatgaaagctcacatgtgaagactacggctaaggtcccattggatgcttacatgatggac
tttgtgttctctgagaaagaggatggcggaatatttgataacaaaaatggtctggattac
catttaccagtcgtgggaggtatttcaaaggaaccaccattgcacattgttcatattgct
gttgaaatggcacccatcgcaaaggttggtggcctaggtgatgttgtcactagtctatct
cgcgctgttcaagaattaaaccataatgtggatatagtttttccaaagtatgattgcata
aagcacaattttgtgaaggacttgcaatttaacagaagctatcactggggaggaactgaa
ataaaagtttggcatggaaaagtagaaggcctttcggtttacttcttagatccacaaaat
ggattgtttcagcgaggatgtgtttacggttgtgcagatgatgcaggaagattcggtttc
ttctgtcatgcggctcttgaatttcttctccaaggaggtttccatccagacattcttcac
tgtcatgactggtctagtgctccggtttcatggttattcaaggatcattacacacagtac
ggtttaattaaaacccgtattgtcttcacaattcataatttggaatttggagcgaatgcc
attggtaaagcaatgacatttgcagacaaagccacaacggtttcaccaacttatgctaag
gaagttgctggaaactctgtaatctctgcacatttatacaaatttcacggaattataaac
gggattgacccagatatatgggatccatataacgataactttattcccgtaccttatact
tcagagaacgttgtagaaggcaaaagagcagccaaggaagaattgcaaaacaggcttgga
ctaaagagtgccgattttccagtagtaggaattattacgcgcttaacacaccagaaggga
atacatttgatcaagcacgctatttggcgtaccttggaacggaatggacaggttgtctta
ttaggttcagctccagatcctcggatccaaaatgattttgtaaacttggcaaaccaatta
cattcttctcatggtgaccgggctcggcttgttctaacctacgatgaacctctttcccat
ttgatttatgctggggctgactttattcttgtaccgtcgatatttgagccatgtggactg
acacagctcatagccatgagatacggcgctgttcctgttgttagaaaaactggaggactc
tttgatacggtttttgatgttgaccacgataaagaaagggcacaagctcaagttctagaa
cctaatggtttcagcttcgacggagctgatgctcctggtgttgattatgctctcaatagg
gcgatatcggcgtggtacgatggtagagagtggtttaactcgctgtgcaagacggtgatg
gagcaagactggtcatggaaccgtcctgcacttgagtatcttgagctctatcactctgca
cgcaagtaa

DBGET integrated database retrieval system