KEGG   Arabidopsis thaliana (thale cress): AT1G12240Help
Entry
AT1G12240         CDS       T00041                                 

Gene name
ATBETAFRUCT4
Definition
(RefSeq) Glycosyl hydrolases family 32 protein
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00052  Galactose metabolism
ath00500  Starch and sucrose metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    AT1G12240 (ATBETAFRUCT4)
   00500 Starch and sucrose metabolism
    AT1G12240 (ATBETAFRUCT4)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     AT1G12240 (ATBETAFRUCT4)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C DUF3357
Motif
Other DBs
NCBI-GeneID: 837777
NCBI-ProteinID: NP_563901
MIPS: AT1G12240.1
TAIR: AT1G12240
Araport: AT1G12240
UniProt: Q39041
Position
1
AA seq 664 aa AA seqDB search
MASSDALLPISAREEEPLCPYTRLPMADPNQETHGPRRRRPFKGLLAVSFGLLFIAFYVA
LIATHDGSRSNDEGIDETETITSRARLAGVSEKRNDGLWKLSGDRNTPAFEWNNSMLSWQ
RTAFHFQPEQNWMNDPNGPLFYKGWYHFFYQYNPNAAVWGDIVWGHAVSRDLIHWVHLPI
AMVADQWYDSNGVWTGSATFLPDGSIVMLYTGSTDKAVQVQNLAYPEDPNDPLLLKWVKF
PGNPVLVPPPGILPKDFRDPTTAWKTSEGKWRITIGSKLNKTGISLVYDTIDFKTYEKLD
TLLHRVPNTGMWECVDFYPVSKTAGNGLDTSVNGPDVKHIVKASMDDTRFDHYAVGTYFD
SNGTWIPDDPTIDVGMTASLRYDYGKFYASKSFYDQNKGRRVLWSWIGESDSEASDVQKG
WSSLQGIPRTVVLDTKTGKNLVQWPVEEIKSLRLSSKQFDLEVGPGSVVPVDVGSAAQLD
IEAEFEINKESLDKIIGNASVVAEAEEFSCEKSGGSTVRGALGPFGFSVLATESLSEQTP
VYFYVAKGKDSELKTFFCTDTSRSSVANDVVKPIYGSVVPVLKGEKLTMRILVDHSIVEA
FGQGGRTCITSRVYPTTAIYGAAKLFLFNNALDATVTASFTVWQMNSAFIHPYSDEAVRA
LSRT
NT seq 1995 nt NT seq  +upstreamnt  +downstreamnt
atggcgagctccgatgctctcttgccaatctccgccagagaagaagaaccattatgtcct
tacacgagattaccaatggccgacccgaatcaagaaacccatggcccccggagaagaaga
ccctttaaaggtctcctcgccgtctcatttggtctcttgttcatcgccttttacgtcgct
ctcatcgccacacacgacggatctagatccaacgacgaagggatcgatgaaacagagacg
ataacgtcacgtgcacgtcttgctggtgtgtcggagaaacgtaacgatgggttatggaaa
ctttccggtgatcggaacacgccggcgtttgaatggaacaatagtatgttgtcgtggcaa
cgaacggcgtttcattttcagcctgagcaaaattggatgaacgatcctaacggtccattg
ttctacaagggatggtaccatttcttctaccaatataacccaaacgcagccgtatggggt
gacattgtttggggtcacgccgtgtctagggacctaatccattgggtccatttgcccata
gccatggtcgctgatcaatggtacgactccaacggtgtgtggaccggctcagccacattt
ctccctgatggctctatagtcatgctctataccggttccaccgacaaagcggtgcaggtc
caaaaccttgcctaccctgaagaccccaacgacccacttctgttgaaatgggtcaagttc
ccggggaacccggttctagtacctccgcccggtatcctccctaaggacttccgtgaccca
acgactgcatggaagacatcagaaggaaaatggcggatcacgattggttccaagctcaac
aaaactggaatctcactcgtgtacgacacaatcgactttaaaacatacgagaaacttgac
acattgttgcaccgagttcccaacactggaatgtgggagtgtgttgacttttacccggtg
tctaagactgcgggcaatgggcttgacacatcggtcaatggaccggatgtgaagcatatc
gtgaaggctagcatggacgacacgaggttcgatcattatgctgtaggcacgtatttcgat
tcaaacggaacatggatccccgatgatcctactatcgatgttgggatgactgccagttta
agatatgattacggaaagttctatgcttcaaagtcgttttacgaccagaacaagggtcga
agagtcttgtggagttggattggtgagtctgatagtgaggcttctgatgtacaaaagggt
tggtcttctctccagggtatcccaagaaccgttgtcctcgacacaaagacaggaaagaac
ttggttcaatggccagtagaagaaatcaaatctcttagactaagcagcaagcaatttgat
ctcgaggtcggtcccgggtcagtggtaccggtcgatgtaggttccgcagctcagctagac
atcgaagcagaattcgagattaacaaagaatctctagacaaaatcatcggaaacgcttcg
gtagtggctgaagccgaggaatttagctgcgaaaaaagcggaggctccaccgtccgtggt
gctttagggccattcggattctcggtacttgccacagagagcttgtctgagcaaacaccg
gtttacttctatgtagctaagggaaaagattcagagctcaaaactttcttctgcacagac
acctcaaggtcatctgttgcaaacgatgtcgttaaaccgatatacggtagcgtcgtaccg
gttctaaaaggggagaaactgaccatgagaattttggtggatcattcgatagtagaagca
ttcggacaaggtggaagaacatgtataacatcaagagtctatccaacaactgcaatctat
ggagcagccaagctcttcttgttcaataatgctcttgatgcgacggttacggcgtcgttt
acagtttggcaaatgaacagtgcttttattcatccttactctgacgaagctgtccgtgct
ctctcccgtacctga

DBGET integrated database retrieval system