KEGG   Arabidopsis thaliana (thale cress): AT1G12244Help
Entry
AT1G12244         CDS       T00041                                 

Definition
(RefSeq) Polynucleotidyl transferase, ribonuclease H-like superfamily protein
  KO
K07447  putative holliday junction resolvase [EC:3.1.-.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT1G12244
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     AT1G12244
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuvX
Motif
Other DBs
NCBI-GeneID: 3766708
NCBI-ProteinID: NP_001031028
MIPS: AT1G12244.1
TAIR: AT1G12244
Araport: AT1G12244
UniProt: F4IC62
Position
1
AA seq 254 aa AA seqDB search
MERTTVILFVFFLLSVAMCSLHSFSSVAISFRTQKYVNTSLVHRLSPIGYRNYPLPWAVT
SIDEIPPNAVRRKIDRNWRGGFSLGVDLGLSRTGIAISKGYTVKPLTVLKSRGQKLETRL
LEIAEEEEADEFIIGLPRSSDGKETIQSNKIRSVAGRLAIQAAERGWRVYVFDEHGTTSE
ASDRMIVMGLSKSERQNRSDAYAAVILLERYFSTQGLGIEIILPKSLELQAKIKNGAPVD
PDFNPENLEEYYTF
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atggaacgaactactgtaatactgttcgtcttcttcttgctctctgtagcaatgtgttct
cttcactctttttcttccgtagcaatttcattcagaactcaaaagtacgtaaatacctct
ctcgttcatcgcttatctcctataggatatcgtaattatcctctaccgtgggcagtgacg
tcaattgacgaaatccctcctaatgctgttcgccggaaaatagaccggaattggagaggt
gggttcagtctcggcgtagatttaggtttatctcgaaccggaatcgctattagtaaaggc
tacaccgttaaacctctcacggttttgaaatcgagagggcaaaaactcgagaccaggctt
ttagaaattgctgaagaagaagaggctgatgaatttataattgggttgccgagatcttct
gatgggaaagagacgattcaatcgaacaaaattcgttctgttgctggacggctcgctatt
caagccgccgagaggggttggagagtttatgtatttgatgaacatggaacaacgtcagaa
gcttcagatagaatgattgtaatgggacttagcaagagtgaaagacagaacagatcagat
gcatatgctgctgtgatattgttggagaggtatttctctacacaaggtttaggaattgag
attatacttcccaagagtttagagcttcaagcaaagatcaagaacggtgcacctgtagac
cccgacttcaatccggaaaacctcgaagagtattacacattctaa

DBGET integrated database retrieval system