KEGG   Arabidopsis thaliana (thale cress): AT1G12550Help
Entry
AT1G12550         CDS       T00041                                 

Gene name
HPR3
Definition
(RefSeq) D-isomer specific 2-hydroxyacid dehydrogenase family protein
  KO
K15919  glyoxylate/hydroxypyruvate reductase [EC:1.1.1.79 1.1.1.81]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00260  Glycine, serine and threonine metabolism
ath00630  Glyoxylate and dicarboxylate metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
ath01200  Carbon metabolism
Module
ath_M00532  Photorespiration
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    AT1G12550 (HPR3)
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    AT1G12550 (HPR3)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.79  glyoxylate reductase (NADP+)
     AT1G12550 (HPR3)
    1.1.1.81  hydroxypyruvate reductase
     AT1G12550 (HPR3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-Hacid_dh_C 2-Hacid_dh NAD_binding_2 ThiF F420_oxidored Shikimate_DH IlvN ApbA
Motif
Other DBs
NCBI-GeneID: 837811
NCBI-ProteinID: NP_172716
MIPS: AT1G12550.1
TAIR: AT1G12550
Araport: AT1G12550
UniProt: Q9LE33
Position
1
AA seq 323 aa AA seqDB search
MAESSEPPVVLLHRPPSLTFMDEILTREFRTLITDTSSSESLPSFFPRHASSARAFVISG
RLPVTDELLSHLPSLQILVCTSVGIDHIDLAACKRRGIVITNAGNAFSDDVADCAVGLLI
SVLRRIPAADRYVRSGNWAKFGDFQLGSKVSGKRVGIVGLGSIGSFVAKRLESFGCVISY
NSRSQKQSSPYRYYSDILSLAENNDVLVLCCSLTDETHHIVNREVMELLGKDGVVINVGR
GKLIDEKEMVKCLVDGVIGGAGLDVFENEPAVPQELFGLDNVVLSPHFAVATPGSLDNVA
QIALANLKAFFSNRPLLSPVQLD
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atggcggaatcttcagagcctccggttgttctccttcaccgaccaccgtctctaactttc
atggacgagattctgactcgtgaattccgtactctcatcaccgacacttcctcatcggaa
tcactcccgagcttcttcccccgtcacgcctcctccgccagagccttcgttatcagcggc
agacttccggtaaccgatgaactcctttctcatctcccttctctccagattctcgtctgc
actagcgtcggcatcgatcacatcgatctcgccgcatgcaagcgtcgcggcatcgttatc
accaacgctggcaacgcgttttccgatgacgttgctgattgtgccgtcggtttgcttatt
agcgttctccgtcgtattcctgccgccgatcgttacgtccggtctggtaattgggcgaaa
tttggggattttcaattagggtccaaggtaagtgggaagagagttgggatagttggattg
gggagcattggatcatttgttgctaaaagacttgaatcatttggctgtgttatctcttac
aactcaaggagtcagaaacagagtagtccataccggtattactctgacattctctcgtta
gcagagaacaacgatgtacttgtcctctgctgctctttgacagacgaaacgcaccatatt
gtgaatagagaagtgatggagttgcttggtaaggatggggttgtgatcaatgtgggacga
ggaaagttgattgatgagaaggagatggtcaagtgtttggttgacggtgtgattggtggt
gctggtttagatgtgtttgagaatgaaccggcagttcctcaggagttgtttggtttggat
aatgtagtgttgtctcctcattttgctgtggctacaccagggtctttggacaatgttgca
cagattgctttagctaacttgaaggcgtttttctcgaaccggcctttgctttctccggtt
caattggattga

DBGET integrated database retrieval system