KEGG   Arabidopsis thaliana (thale cress): AT1G15390Help
Entry
AT1G15390         CDS       T00041                                 

Gene name
PDF1A
Definition
(RefSeq) peptide deformylase 1A
  KO
K01462  peptide deformylase [EC:3.5.1.88]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT1G15390 (PDF1A)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.88  peptide deformylase
     AT1G15390 (PDF1A)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pep_deformylase
Motif
Other DBs
NCBI-GeneID: 838109
NCBI-ProteinID: NP_563974
MIPS: AT1G15390.1
TAIR: AT1G15390
Araport: AT1G15390
UniProt: Q9FV53 A0A178WDP8
Structure
PDB: 

Position
1
AA seq 269 aa AA seqDB search
MGLHRDEATAMETLFRVSLRLLPVSAAVTCRSIRFPVSRPGSSHLLNRKLYNLPTSSSSS
LSTKAGWLLGLGEKKKKVDLPEIVASGDPVLHEKAREVDPGEIGSERIQKIIDDMIKVMR
LAPGVGLAAPQIGVPLRIIVLEDTKEYISYAPKEEILAQERRHFDLMVMVNPVLKERSNK
KALFFEGCLSVDGFRAAVERYLEVVVTGYDRQGKRIEVNASGWQARILQHECDHLDGNLY
VDKMVPRTFRTVDNLDLPLAEGCPKLGPQ
NT seq 810 nt NT seq  +upstreamnt  +downstreamnt
atgggactccaccgagacgaagcgacggccatggaaacccttttcagagtctcacttcgt
ctacttccggtttccgccgccgtgacatgtcgctcgatccgattccccgtttcaagaccc
ggttcctcacacttactgaaccgtaagctgtataatttgcctacttcttcttcctcctct
ttgtcgacaaaagccggttggttattgggtcttggtgagaagaaaaagaaagtggattta
ccggagatagtggcatctggtgacccggttctgcacgagaaggcccgagaagttgacccg
ggagaaatcgggtcggagcgtattcagaagataattgatgatatgattaaagttatgaga
ttggctcctggagttggcctcgctgctcctcaaattggtgttcccttaaggattattgta
ttggaagatacaaaagagtatataagttacgcaccaaaggaagagattcttgctcaagaa
agacgtcattttgatctcatggtgatggtgaatccggttctcaaggagagaagcaacaag
aaagctcttttctttgaaggatgcttgagtgttgatggattcagagctgcggtggagaga
taccttgaggtggtagtgacgggctacgatcgtcaaggaaagaggattgaagtgaatgct
tcaggttggcaagctaggattttgcaacatgagtgtgatcatttggatggtaatctttac
gttgataagatggtaccacgcacttttaggacagtcgacaacttggacttgcctttagct
gagggctgccctaagctcggacctcaatga

DBGET integrated database retrieval system