KEGG   Arabidopsis thaliana (thale cress): AT1G16010
Entry
AT1G16010         CDS       T00041                                 
Symbol
MGT2
Name
(RefSeq) magnesium transporter 2
  KO
K16075  magnesium transporter
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G16010 (MGT2)
Transporters [BR:ath02000]
 Other transporters
  Pores ion channels [TC:1]
   AT1G16010 (MGT2)
SSDB
Motif
Pfam: CorA Filament Claudin_2 DUF4456 ZapB
Other DBs
NCBI-GeneID: 838171
NCBI-ProteinID: NP_001077545
TAIR: AT1G16010
UniProt: Q9S9N4 A0A178WMI6
Position
1:complement(5495373..5497723)
AA seq 442 aa
MSELKERLLPPRPASAMNLRDASVTRPSASGRPPLLGVDVLGLKKRGQGLRSWIRVDTSG
NTQVMEVDKFTMMRRCDLPARDLRLLDPLFVYPSTILGREKAIVVNLEQIRCIITADEVL
LLNSLDNYVLRYVVELQQRLKTSSVGEMWQQENSQLSRRRSRSFDNAFENSSPDYLPFEF
RALEIALEAACTFLDSQASELEIEAYPLLDELTSKISTLNLERVRRLKSRLVALTRRVQK
VRDEIEQLMDDDGDMAEMYLTEKKRRMEGSMYGDQSLLGYRSNDGLSVSAPVSPVSSPPD
SRRLDKSLSIARSRHDSARSSEGAENIEELEMLLEAYFVVIDSTLNKLTSLKEYIDDTED
FINIQLDNVRNQLIQFELLLTTATFVVAIFGVVAGIFGMNFEIDFFNQPGAFRWVLIITG
VCGFVIFSAFVWFFKYRRLMPL
NT seq 1329 nt   +upstreamnt  +downstreamnt
atgtctgagctaaaagagcgcctgcttcctccaagacctgcttcagctatgaacctcaga
gatgcttctgtgactcggccttctgcttctggaagaccaccccttcttggagttgatgtc
ttgggtctgaagaagcgtggacaaggcctacgctcttggattcgtgttgatacttctggt
aatactcaggtcatggaggttgacaagttcactatgatgcgtaggtgtgacttacccgcc
cgtgatttaaggctgcttgatcccttattcgtgtatccctctactatcctaggccgagag
aaggctattgttgtcaacttagagcagatccgttgtattattactgcagacgaagttctg
cttctgaattcccttgacaactacgtgctgcgctatgttgttgagttgcagcagagacta
aagactagtagtgtaggtgagatgtggcagcaggaaaattcccagttgagtaggaggagg
agcaggagttttgacaatgcttttgagaattcatcccctgattatttacctttcgagttt
agagctcttgaaatagcccttgaagctgcttgtacgtttctcgattcccaggcttcagag
ttggagattgaggcatacccgttattagatgagcttacctcaaagatcagtacactaaac
ttggagcgtgtgcgtagactaaagagcaggcttgtagcactgacaagaagagttcagaag
gttcgggatgagatcgagcagctaatggatgatgatggagatatggcagaaatgtatcta
acagagaagaagaggagaatggaaggatctatgtacggtgaccagtccttattgggttac
aggtcaaatgatggtctatctgtttctgcaccggtgtctcctgtttcttctccacctgat
tcccgaagacttgataaaagcttgagcattgcgaggagtcggcatgacagtgcaaggagt
tctgaaggtgcagagaatatagaagagctagagatgttgctggaagcttactttgtcgtc
attgatagtactctaaacaagttgacatcgttaaaggagtacattgatgacactgaagat
ttcattaacattcaactggataatgtgcggaatcagctgatccagttcgagttgcttctg
acgactgcaacgtttgttgtagccatatttggggtcgttgctgggatctttgggatgaac
tttgagatagacttcttcaatcagccaggtgcattcagatgggtactcataattactgga
gtatgtggctttgtgatattttcggcattcgtctggttcttcaagtacagaagactcatg
cctctataa

DBGET integrated database retrieval system