KEGG   Arabidopsis thaliana (thale cress): AT1G17710Help
Entry
AT1G17710         CDS       T00041                                 

Gene name
PEPC1
Definition
(RefSeq) Pyridoxal phosphate phosphatase-related protein
  KO
K13248  pyridoxal phosphate phosphatase PHOSPHO2 [EC:3.1.3.74]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00750  Vitamin B6 metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    AT1G17710 (PEPC1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:ath01009]
    AT1G17710 (PEPC1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.74  pyridoxal phosphatase
     AT1G17710 (PEPC1)
Protein phosphatases and associated proteins [BR:ath01009]
 HAD phosphatases
  Other HAD phosphatases
   AT1G17710 (PEPC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Put_Phosphatase HAD HAD_2 Hydrolase MerR_1
Motif
Other DBs
NCBI-GeneID: 838347
NCBI-ProteinID: NP_173213
MIPS: AT1G17710.1
TAIR: AT1G17710
Araport: AT1G17710
UniProt: Q9FZ62
Position
1
AA seq 279 aa AA seqDB search
MAKNNNIVIVFDFDKTIIDVDSDNWVVDELGFTDLFNQLLPTMPWNSLMNRMMKELHDHG
KTIEEIKQVLRRIPIHPRVIPAIKSAHALGCELRIVSDANTLFIETIIEHLGIGEFFSEI
NTNPGLVDEQGRLIVSPYHDFTKSSHGCSRCPPNMCKGLIIDRIQASLTKEGKTSKMIYL
GDGAGDYCPSLGLKAEDYMMPRKNFPVWDLISQNPMLVKATVRDWTDGEDMERILMEIIN
EIMSSEEGEENDKMLSSENCKISVGIVHEPIQVPLNLVK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atggctaagaataacaacatcgtgatcgtcttcgattttgacaagacaatcatcgatgta
gacagcgataattgggtcgtggatgaacttggtttcactgatttgttcaaccagcttctc
ccaacaatgccttggaactctctcatgaatcggatgatgaaggagcttcatgatcatggt
aaaaccattgaagaaatcaaacaagtccttaggagaatcccaattcatccacgtgtcatc
ccagccatcaaatctgctcatgctttagggtgcgagctgagaatagtgagcgacgcaaac
acgttgttcatcgaaacaatcattgaacatctcgggattggtgagtttttctccgagatt
aacacaaatccaggacttgtagatgaacaaggaagattaatagtctctccttaccatgac
ttcaccaaatcttctcatggttgctctcgttgccctcctaacatgtgcaagggtttaata
atcgataggattcaagcttctctaacgaaagaagggaagacgagcaagatgatctatctt
ggagatggtgctggtgattactgtcccagtcttggactcaaagctgaagattacatgatg
ccaaggaagaatttcccggtttgggatttgattagtcaaaatcccatgttggttaaggct
accgttagagattggaccgatggagaagatatggagaggatactaatggaaataatcaac
gaaattatgtcatcagaggaaggagaggagaatgacaagatgttgagctctgaaaactgc
aagatatctgttgggattgttcatgaacctattcaagttcctttaaatttggtcaagtga

DBGET integrated database retrieval system