KEGG   Arabidopsis thaliana (thale cress): AT1G17950Help
Entry
AT1G17950         CDS       T00041                                 

Gene name
MYB52
Definition
(RefSeq) myb domain protein 52
  KO
K09422  transcription factor MYB, plant
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G17950 (MYB52)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Helix-turn-helix
   Tryptophan clusters Myb, Myb-factors
    AT1G17950 (MYB52)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Myb_DNA-binding Myb_DNA-bind_6 Myb_DNA-bind_7
Motif
Other DBs
NCBI-GeneID: 838374
NCBI-ProteinID: NP_173237
MIPS: AT1G17950.1
TAIR: AT1G17950
Araport: AT1G17950
UniProt: Q6R0C4
Position
1
AA seq 249 aa AA seqDB search
MMCSRGHWRPAEDEKLRELVEQFGPHNWNAIAQKLSGRSGKSCRLRWFNQLDPRINRNPF
TEEEEERLLASHRIHGNRWSVIARFFPGRTDNAVKNHWHVIMARRGRERSKLRPRGLGHD
GTVAATGMIGNYKDCDKERRLATTTAINFPYQFSHINHFQVLKEFLTGKIGFRNSTTPIQ
EGAIDQTKRPMEFYNFLQVNTDSKIHELIDNSRKDEEEDVDQNNRIPNENCVPFFDFLSV
GNSASQGLC
NT seq 750 nt NT seq  +upstreamnt  +downstreamnt
atgatgtgtagtcgaggccattggagacctgcagaagacgagaagctaagagaactcgtc
gaacaatttggtcctcataattggaacgccatagctcagaagctctctggtcgatctggt
aagagttgtagattgagatggtttaatcaattggatcctaggattaaccgaaaccctttc
acggaggaagaagaagaaaggcttttagcgtctcatcggatccatgggaacagatggtct
gtgatcgctagattttttcccggtcgaactgataacgctgttaaaaaccattggcacgtc
atcatggctcgtcgtggccgagaacggtccaagctccgtccacgaggccttggccatgat
ggcacggtggctgcgactgggatgattggtaattataaagactgcgataaggagagaaga
ttggcaaccacaaccgctatcaattttccttatcaattctctcatattaatcattttcaa
gtcctcaaagagttcttgaccggaaagatcgggttcagaaatagtactactccaatacaa
gaaggagcaatagaccaaactaaacgaccgatggagttctacaattttcttcaagtaaac
acggattcgaagatacacgaattgatagataattcaagaaaagacgaagaagaagatgtc
gatcaaaacaaccgaattcctaacgagaattgtgttccatttttcgactttttgtctgtt
ggaaactctgcctctcagggtttatgttaa

DBGET integrated database retrieval system