KEGG   Arabidopsis thaliana (thale cress): AT1G18350Help
Entry
AT1G18350         CDS       T00041                                 

Gene name
MKK7
Definition
(RefSeq) MAP kinase kinase 7
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like FTA2 APH Pkinase_fungal Orbi_NS1 Choline_kinase
Motif
Other DBs
NCBI-GeneID: 838416
NCBI-ProteinID: NP_173271
MIPS: AT1G18350.1
TAIR: AT1G18350
Araport: AT1G18350
UniProt: Q9LPQ3 A0A178W604
Position
1
AA seq 307 aa AA seqDB search
MALVRKRRQINLRLPVPPLSVHLPWFSFASSTAPVINNGISASDVEKLHVLGRGSSGIVY
KVHHKTTGEIYALKSVNGDMSPAFTRQLAREMEILRRTDSPYVVRCQGIFEKPIVGEVSI
LMEYMDGGNLESLRGAVTEKQLAGFSRQILKGLSYLHSLKIVHRDIKPANLLLNSRNEVK
IADFGVSKIITRSLDYCNSYVGTCAYMSPERFDSAAGENSDVYAGDIWSFGVMILELFVG
HFPLLPQGQRPDWATLMCVVCFGEPPRAPEGCSDEFRSFVDCCLRKESSERWTASQLLGH
PFLRESL
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atggctcttgttcgtaaacgccgtcaaatcaacctccgtctccctgtcccaccgctctct
gttcacctcccctggttctcctttgcctcatccaccgcccccgtcatcaacaacggaatc
tcagcttccgatgtcgagaaactccacgttctcggaagaggaagcagcgggatcgtatac
aaagtccaccacaaaaccacgggggagatatacgctctgaaatcagtcaacggcgacatg
agtcctgctttcacaagacaattagcgcgcgagatggagatcctccgtcgcacggattct
ccttatgtcgtcaggtgtcaagggatcttcgagaaaccaatcgtcggagaggtttcgatc
ctcatggagtatatggacggtggaaacctagaatctctccgcggcgccgttacggagaaa
caactagcgggattttcccgccagattttgaaaggtttaagttatctccactcactcaag
atcgttcacagagacatcaaacctgcgaatctactcttaaactcgagaaacgaagttaaa
atcgctgattttggagtgagcaaaatcattacccgatcgttagattactgcaattcctac
gtcggcacttgcgcttacatgagcccggagagatttgactctgccgccggagaaaactcc
gatgtttacgcaggcgatatctggagtttcggagtgatgatacttgagctcttcgtcgga
cattttccgttgcttcctcagggacagagacctgactgggcgacgttaatgtgcgtcgtg
tgctttggagaaccaccgcgtgcgccggaaggatgttccgacgagtttaggagttttgtt
gactgttgtctccgtaaagaatcgagtgagaggtggacggcgtcgcagcttctcggtcac
ccttttctccgtgaaagtctttag

DBGET integrated database retrieval system