KEGG   Arabidopsis thaliana (thale cress): AT1G18485Help
Entry
AT1G18485         CDS       T00041                                 

Definition
(RefSeq) Pentatricopeptide repeat (PPR) superfamily protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: PPR PPR_2 DYW_deaminase PPR_1 PPR_3 PPR_long
Motif
Other DBs
NCBI-GeneID: 838429
NCBI-ProteinID: NP_564054
MIPS: AT1G18485.1
TAIR: AT1G18485
Araport: AT1G18485
UniProt: Q0WN60
Position
1
AA seq 970 aa AA seqDB search
MASVLLPLPQVFVLFDYRRSRKESSFPRAVYNSNSISSNSTNANHFLRRISNFCETGDLD
KSFRTVQEFVGDDESSSDAFLLVREALGLLLQASGKRKDIEMGRKIHQLVSGSTRLRNDD
VLCTRIITMYAMCGSPDDSRFVFDALRSKNLFQWNAVISSYSRNELYDEVLETFIEMIST
TDLLPDHFTYPCVIKACAGMSDVGIGLAVHGLVVKTGLVEDVFVGNALVSFYGTHGFVTD
ALQLFDIMPERNLVSWNSMIRVFSDNGFSEESFLLLGEMMEENGDGAFMPDVATLVTVLP
VCAREREIGLGKGVHGWAVKLRLDKELVLNNALMDMYSKCGCITNAQMIFKMNNNKNVVS
WNTMVGGFSAEGDTHGTFDVLRQMLAGGEDVKADEVTILNAVPVCFHESFLPSLKELHCY
SLKQEFVYNELVANAFVASYAKCGSLSYAQRVFHGIRSKTVNSWNALIGGHAQSNDPRLS
LDAHLQMKISGLLPDSFTVCSLLSACSKLKSLRLGKEVHGFIIRNWLERDLFVYLSVLSL
YIHCGELCTVQALFDAMEDKSLVSWNTVITGYLQNGFPDRALGVFRQMVLYGIQLCGISM
MPVFGACSLLPSLRLGREAHAYALKHLLEDDAFIACSLIDMYAKNGSITQSSKVFNGLKE
KSTASWNAMIMGYGIHGLAKEAIKLFEEMQRTGHNPDDLTFLGVLTACNHSGLIHEGLRY
LDQMKSSFGLKPNLKHYACVIDMLGRAGQLDKALRVVAEEMSEEADVGIWKSLLSSCRIH
QNLEMGEKVAAKLFELEPEKPENYVLLSNLYAGLGKWEDVRKVRQRMNEMSLRKDAGCSW
IELNRKVFSFVVGERFLDGFEEIKSLWSILEMKISKMGYRPDTMSVQHDLSEEEKIEQLR
GHSEKLALTYGLIKTSEGTTIRVYKNLRICVDCHNAAKLISKVMEREIVVRDNKRFHHFK
NGVCSCGDYW
NT seq 2913 nt NT seq  +upstreamnt  +downstreamnt
atggcttctgttttgcttccattgccacaagtatttgttttgtttgattatcgcaggagc
cgtaaagagtcaagctttccccgcgccgtctacaattccaattccatttcttctaattca
accaatgccaatcatttccttcgccggatttctaacttctgtgaaaccggagacctcgac
aagtcctttcgaactgtccaagaattcgttggcgatgacgagagctcgtccgatgcgttt
cttcttgtccgagaagctcttgggcttctcttacaagcttctgggaagagaaaagacatt
gaaatgggaagaaagatccaccagctggtttctgggtcgacccggttaaggaatgatgac
gttctctgtactcgtattatcaccatgtacgctatgtgtggctctcctgatgattctcgg
tttgtgtttgatgccttgcggagtaagaatctcttccagtggaatgctgttatcagctct
tactcaagaaacgagctttacgatgaagtattagagacgtttatcgagatgatctcaacg
actgatcttttaccggatcatttcacttatccatgtgtgattaaggcttgtgctgggatg
tctgatgttgggatcgggcttgcggttcatgggttggtggtgaagaccggattggtggaa
gatgtttttgtgggtaatgcattggtgtctttctatggaactcatggttttgttactgat
gccttgcaactgttcgatataatgcctgagagaaatttggtttcctggaactccatgatt
cgagtgttctcggataatggtttctcagaagaaagcttcttgcttcttggagaaatgatg
gaggaaaatggtgatggtgcgtttatgccggatgttgctacacttgttactgtgttgccg
gtttgtgcaagagaaagagaaatagggttgggaaaaggtgttcatgggtgggcggtgaaa
ttgaggttggacaaggaactagtccttaacaatgccttaatggacatgtactccaaatgc
ggttgcattactaatgcacaaatgatctttaagatgaacaataacaagaatgtggtttct
tggaacacaatggtaggaggtttttcagcagagggtgatacacatgggacgtttgatgtt
ctgagacagatgctggcaggaggcgaagatgtcaaagcggacgaggtaaccattctaaat
gcagtgcctgtttgtttccatgaatcattcttaccgagtttaaaggaacttcattgttac
tccttaaaacaagagtttgtatacaatgagttagtagccaatgcctttgtggcttcttat
gcaaagtgtggctcactgagttatgcccagcgtgtgtttcatggtataaggagtaaaaca
gtgaactcttggaatgctttgattggcggccatgctcagagcaatgatccgagattgtcc
ttggatgctcatttgcagatgaaaatttctggattgctacctgatagttttactgtctgt
agtcttctttcagcttgttctaaactaaaatccctgcggttgggaaaggaagtgcatggg
tttataatccgaaattggttagaaagagatttgtttgtttatttatcagtactctcatta
tacattcattgtggggagctatgcactgtacaagcattatttgatgcaatggaagataaa
agcttagtatcttggaatactgtaatcaccggttaccttcagaatggatttcctgataga
gctttgggcgtctttagacaaatggttttgtatggaatccagctttgtgggatttctatg
atgcctgtgtttggtgcgtgttcgctgctaccttctcttcgactggggagagaagcgcat
gcttatgctttgaagcacctcctggaggacgatgcgtttattgcatgttctttaattgat
atgtatgccaagaatggttctataacacaatcatctaaggttttcaatggcttgaaggag
aaaagcacggcatcttggaatgccatgataatgggatatggaatacatggcctagcaaaa
gaggctataaaactctttgaagagatgcaaagaacaggtcataaccctgatgacctaact
ttcttaggtgttctaacggcttgcaaccatagtggtctgatccatgaagggctgagatat
ctggatcaaatgaagtcttcttttgggctaaagccaaatttaaagcattatgcttgtgtc
attgacatgttaggccgagctgggcaactagacaaggctctaagggttgttgcagaagag
atgtctgaggaagctgacgttggaatttggaagtctctgctcagctcatgcagaatccat
caaaatctggaaatgggagagaaagttgctgctaagttattcgaattagaaccagaaaag
cctgagaattatgttctgctttccaacttatatgcaggattggggaaatgggaagacgtg
agaaaagtgagacagagaatgaacgagatgagtttacgaaaggatgctggatgctcttgg
atcgaactaaacaggaaggtatttagctttgttgtcggtgaaagattcttagatggtttt
gaggaaatcaaaagtctttggagtatattggagatgaagatatcgaagatgggatacaga
ccagacacaatgtcagtacaacatgatctaagtgaagaggagaagattgaacagttaagg
ggacacagcgagaagcttgcccttacctacgggttgattaaaacttcagaaggaacaact
attagagtttacaagaacctaaggatctgtgtggactgtcacaatgcagcaaagttgatc
tccaaggtcatggaaagggaaatagttgtgagggacaacaaaaggtttcatcatttcaag
aatggggtttgttcttgtggagattactggtaa

DBGET integrated database retrieval system