KEGG   Arabidopsis thaliana (thale cress): AT1G20260Help
Entry
AT1G20260         CDS       T00041                                 

Gene name
VAB3
Definition
(RefSeq) ATPase, V1 complex, subunit B protein
  KO
K02147  V-type H+-transporting ATPase subunit B
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00190  Oxidative phosphorylation
ath01100  Metabolic pathways
ath04145  Phagosome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    AT1G20260 (VAB3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04145 Phagosome
    AT1G20260 (VAB3)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:ath04147]
    AT1G20260 (VAB3)
Exosome [BR:ath04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   AT1G20260 (VAB3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N HAS-barrel
Motif
Other DBs
NCBI-GeneID: 838614
NCBI-ProteinID: NP_173451
MIPS: AT1G20260.1
TAIR: AT1G20260
Araport: AT1G20260
UniProt: Q8W4E2 A0A178WCF6
Position
1
AA seq 487 aa AA seqDB search
MVETSIDMEEGTLEIGMEYRTVSGVAGPLVILDKVKGPKYQEIVNIRLGDGSTRRGQVLE
VDGEKAVVQVFEGTSGIDNKFTTVQFTGEVLKTPVSLDMLGRIFNGSGKPIDNGPPILPE
AYLDISGSSINPSERTYPEEMIQTGISTIDVMNSIARGQKIPLFSAAGLPHNEIAAQICR
QAGLVKRLEKTENLIQEDHGEDNFAIVFAAMGVNMETAQFFKRDFEENGSMERVTLFLNL
ANDPTIERIITPRIALTTAEYLAYECGKHVLVILTDMSSYADALREVSAAREEVPGRRGY
PGYMYTDLATIYERAGRIEGRKGSITQIPILTMPNDDITHPTPDLTGYITEGQIYIDRQL
HNRQIYPPINVLPSLSRLMKSAIGEGMTRKDHSDVSNQLYANYAIGKDVQAMKAVVGEEA
LSSEDLLYLEFLDKFERKFVMQGAYDTRNIFQSLDLAWTLLRIFPRELLHRIPAKTLDQF
YSRDSTS
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggtggagactagtatcgacatggaggaaggaactctcgagatcggaatggagtataga
actgtctccggagttgctggacctttggtcatccttgacaaagtgaagggtccaaagtac
caggagattgttaatattcgcttaggagatggatcaacgagacgtggtcaggtcttggag
gttgatggggagaaagctgttgtccaggtttttgaaggaacatctgggattgacaacaag
tttaccaccgtgcaattcacaggagaggtactgaaaacgcctgtgtcattggacatgctt
ggccgcatatttaacggctcgggaaagccaattgataatggccctcctattttgccagag
gcataccttgatatttctggaagttcaatcaaccccagtgaaagaacctaccctgaagag
atgatacaaacggggatttctaccattgatgtcatgaactccattgctcgtggacagaag
attcctcttttctctgctgctggtctacctcataatgagattgctgctcaaatttgtcgt
caggctggacttgtgaagcggttggaaaagactgagaacttaattcaggaggatcatgga
gaggacaattttgcaattgtttttgcagctatgggtgtaaacatggagacagctcagttt
ttcaagcgtgattttgaagaaaatggatcgatggaaagggttacccttttcctgaacttg
gccaatgatccaaccattgagagaattatcactcctcgaattgccctaacaaccgctgaa
tatttggcttatgaatgtggaaagcatgtgcttgttatattgacagacatgagttcttat
gcagatgctcttcgtgaggtttctgctgctcgagaagaagttcctggaagacgtggatat
ccggggtatatgtatacagatcttgcaactatttatgaacgcgcgggacgtattgaagga
agaaagggttccattacccaaatccctatcctgactatgcccaatgacgatatcactcac
cctactccggatcttactggttacattactgagggtcagatatatattgataggcaactt
cacaacagacagatatacccacccattaacgtgcttccatcactttctcggctgatgaag
agtgctattggtgaaggaatgactcgcaaagaccattctgatgtgtccaaccagctatac
gcaaattatgcaatcggaaaagatgttcaagccatgaaagctgttgttggagaagaagct
ctgtcttccgaggatctgctgtatttagagtttctggataaatttgaaaggaagtttgtg
atgcaaggcgcatacgatacaaggaacatcttccagtcgcttgacttggcatggacactg
ctccgtatcttcccacgtgagcttcttcaccgtattcctgccaaaacacttgatcaattc
tacagccgcgactccacaagctaa

DBGET integrated database retrieval system