KEGG   Arabidopsis thaliana (thale cress): AT1G20510
Entry
AT1G20510         CDS       T00041                                 
Symbol
OPCL1
Name
(RefSeq) OPC-8:0 CoA ligase1
  KO
K10526  OPC-8:0 CoA ligase 1 [EC:6.2.1.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00592  alpha-Linolenic acid metabolism
ath01100  Metabolic pathways
ath01110  Biosynthesis of secondary metabolites
Module
ath_M00113  Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    AT1G20510 (OPCL1)
Enzymes [BR:ath01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.-
     AT1G20510 (OPCL1)
SSDB
Motif
Pfam: AMP-binding AMP-binding_C
Other DBs
NCBI-GeneID: 838639
NCBI-ProteinID: NP_564115
TAIR: AT1G20510
UniProt: Q84P21 A0A5S9VC39
Position
1:complement(7103362..7106121)
AA seq 546 aa
MASVNSRSGFCNSNSTFYSKRTPIPLPPNPSLDVTTFISSQAHRGRIAFIDASTGQNLTF
TELWRAVESVADCLSEIGIRKGHVVLLLSPNSILFPVVCLSVMSLGAIITTTNPLNTSNE
IAKQIKDSNPVLAFTTSQLLPKISAAAKKLPIVLMDEERVDSVGDVRRLVEMMKKEPSGN
RVKERVDQDDTATLLYSSGTTGMSKGVISSHRNLIAMVQTIVNRFGSDDGEQRFICTVPM
FHIYGLAAFATGLLAYGSTIIVLSKFEMHEMMSAIGKYQATSLPLVPPILVAMVNGADQI
KAKYDLSSMHTVLCGGAPLSKEVTEGFAEKYPTVKILQGYGLTESTGIGASTDTVEESRR
YGTAGKLSASMEGRIVDPVTGQILGPKQTGELWLKGPSIMKGYFSNEEATSSTLDSEGWL
RTGDLCYIDEDGFIFVVDRLKELIKYKGYQVAPAELEALLLTHPEITDAAVIPFPDKEVG
QFPMAYVVRKTGSSLSEKTIMEFVAKQVAPYKRIRKVAFVSSIPKNPSGKILRKDLIKIA
TSNSKL
NT seq 1641 nt   +upstreamnt  +downstreamnt
atggcttcagtgaattctcgaagtggtttctgcaactcaaactcaacattctacagcaaa
cgaacaccaatcccactcccgccaaatccatcactcgacgtcactactttcatttcttca
caagctcatcgtggccgtatcgccttcatcgacgcttccacaggtcaaaacctcaccttc
accgagctatggcgtgccgtggaatccgtcgccgattgtctctccgagatagggattcgc
aaaggccacgtcgtcctcctcctctccccaaactcaattttattccccgtcgtttgtctc
tccgtcatgtcactaggcgcaatcatcaccaccacgaatccactcaacacttcaaacgag
atcgctaaacagattaaggattcaaatccagtcctcgccttcaccacatcgcagcttctc
ccgaaaatctccgccgccgcaaagaagctcccgatcgtgcttatggacgaggaacgagtt
gactcagtgggtgatgtgagaagattggtggagatgatgaagaaggaaccgagtgggaac
cgagtcaaggagcgagttgaccaggatgatacggcgactttgctttactcttcaggaacc
acgggaatgagcaaaggagtgatctcgtctcaccgtaacttaatcgcgatggttcaaacc
atcgtgaatcgatttggatctgatgatggagagcaacgattcatctgcactgttcctatg
tttcacatctacggtttagctgcgttcgctactggattactcgcttacggatctacgatc
atcgttctctctaaattcgagatgcacgagatgatgtcagcgattggcaagtatcaagcc
acgtctttgcctctcgtgcctccgattcttgtggcgatggttaacggtgcagatcagatt
aaggctaagtatgatttgagctctatgcatactgttttatgcggcggagctccgttgagt
aaggaagtgactgaaggattcgcggagaagtatccgacggttaagattttacaaggttat
gggttgactgagtcaacgggtataggagcttctacggatactgttgaggaaagtcggaga
tacggtaccgctgggaaattgtcggcaagtatggaagggaggattgttgatccggttact
ggtcagattcttggaccgaaacaaaccggtgagctttggctcaagggtccttccataatg
aaaggttatttcagcaatgaggaagctacgagttcgactcttgattctgaaggatggtta
agaactggagatctttgctatatcgatgaagatggattcatattcgtggttgatcggtta
aaggaactgatcaagtacaagggttatcaggttgctccagctgagctagaggctttgttg
cttactcatcctgaaatcactgatgctgcagtgatcccgtttccggacaaagaagtgggg
caatttccaatggcatacgtcgtaaggaaaactgggagcagcttatcagagaagacaata
atggagtttgtagcgaaacaagtagcaccatacaagaggatacgaaaagttgctttcgta
tcttcaataccaaagaacccttcaggcaagattctacgcaaagatctcatcaagatagca
acttccaactccaagctttga

DBGET integrated database retrieval system