KEGG   Arabidopsis thaliana (thale cress): AT1G21070
Entry
AT1G21070         CDS       T00041                                 
Name
(RefSeq) Nucleotide-sugar transporter family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: TPT EamA UAA SLC35F AWPM-19
Other DBs
NCBI-GeneID: 838703
NCBI-ProteinID: NP_564133
TAIR: AT1G21070
UniProt: Q9LPU2 A0A178WCN2
Position
1:complement(7375869..7378227)
AA seq 348 aa
MEKAENEKKPSAVSDVGAWAMNVTSSVGIIMANKQLMSSSGFGFSFATTLTGFHFALTAL
VGMVSNATGLSASKHVPLWELLWFSLVANISIAAMNFSLMLNSVGFYQISKLSMIPVVCV
MEWVLHSKHYSREVKASVMVVVVGVGICTVTDVKVNAKGFICACTAVFSTSLQQISIGSL
QKKYSIGSFELLSKTAPIQAISLLIFGPFVDYFLSGRFISTYKMTYSAMLCILLSCALAV
FCNISQYLCIGRFSATSFQVLGHMKTVCVLTLGWLIFDSEMTFKNIAGMVLAVVGMVIYS
WAVELEKQRKSKVIPHGKHSMTEDEIKLLKEGIEHMDLKDMELGNNKA
NT seq 1047 nt   +upstreamnt  +downstreamnt
atggagaaagcagagaacgagaagaagccatcggctgtatctgacgtcggagcatgggct
atgaacgtaacgagctccgttgggatcatcatggctaataaacaactaatgtcatcatct
ggattcggcttcagcttcgcgacaactctcacgggatttcactttgctcttactgctctc
gttggtatggtgtcgaatgcgactggtttatcagcatctaagcatgttcctctttgggag
cttctttggttctcactcgttgctaatatctcaatcgctgctatgaattttagtcttatg
ttgaactctgttggcttctaccagatatcgaaattgagcatgattccagttgtttgtgtg
atggaatgggttctacatagtaagcattactcgagagaagtgaaggcatctgtcatggtt
gttgttgtaggagttgggatttgtactgttactgatgtcaaagttaatgccaaaggtttc
atttgtgcttgcactgccgttttctccacttctctccagcagatctcaataggttcactg
cagaagaaatactcgatcggatcattcgagttgctgagtaagacagctccaatccaagcc
atttcactcctcatctttggtccatttgttgactatttcttgagtggcagattcatttcg
acttacaagatgacttatagcgcaatgttatgcattcttctctcctgcgcattggcggtt
ttctgcaacataagccaatatctctgcatcggaagattctctgctacctcattccaagtt
cttggccacatgaaaacagtctgtgtcttaacattaggatggcttatctttgattcggag
atgacattcaagaacatagcagggatggtcttagccgtggtgggaatggtgatatacagt
tgggcagtcgagttagagaaacagagaaagtcgaaagtgataccgcatggtaaacacagt
atgacagaagatgagattaaacttctcaaagaaggtatagaacatatggatttgaaagac
atggagcttggaaataataaagcataa

DBGET integrated database retrieval system