KEGG   Arabidopsis thaliana (thale cress): AT1G21460
Entry
AT1G21460         CDS       T00041                                 
Symbol
SWEET1
Name
(RefSeq) Nodulin MtN3 family protein
  KO
K15382  solute carrier family 50 (sugar transporter)
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G21460 (SWEET1)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC50: Sugar efflux transporter
   AT1G21460 (SWEET1)
SSDB
Motif
Pfam: MtN3_slv SCAMP
Other DBs
NCBI-GeneID: 838744
NCBI-ProteinID: NP_564140
TAIR: AT1G21460
UniProt: Q8L9J7 A0A178WKY1
Position
1:complement(7511750..7513481)
AA seq 247 aa
MNIAHTIFGVFGNATALFLFLAPSITFKRIIKNKSTEQFSGIPYPMTLLNCLLSAWYGLP
FVSKDNTLVSTINGTGAVIETVYVLIFLFYAPKKEKIKIFGIFSCVLAVFATVALVSLFA
LQGNGRKLFCGLAATVFSIIMYASPLSIMRLVVKTKSVEFMPFFLSLFVFLCGTSWFVYG
LIGRDPFVAIPNGFGCALGTLQLILYFIYCGNKGEKSADAQKDEKSVEMKDDEKKQNVVN
GKQDLQV
NT seq 744 nt   +upstreamnt  +downstreamnt
atgaacatcgctcacactatcttcggcgttttcggaaatgcaactgctctgtttcttttc
ttggctccttcgataacattcaagagaatcatcaagaacaaatccactgaacaattctct
ggtatcccttatccaatgactctcctcaactgtctcctctctgcttggtatggacttccc
tttgtgtcaaaagacaacacacttgtgagcacaatcaatggcacaggagcagtgatcgaa
acagtctacgtgttaatctttcttttctacgcaccaaagaaggagaaaattaagatcttt
ggtatcttctcttgcgttttggctgtattcgcaacagtagctctcgtctctctctttgct
cttcaaggaaacggtagaaaactcttttgtggtctcgcagctactgttttctccatcatc
atgtacgcttctccactctccatcatgagattggtggtaaagacgaagagtgtagagttt
atgccattctttttgtcactctttgtcttcctctgtggtacttcgtggttcgtctatggt
ctaatcggtcgtgacccttttgttgcaatcccaaatgggtttggatgtgcattagggaca
ctgcaattgatactatacttcatctactgtggaaacaaaggagagaaatctgcagatgct
cagaaagatgagaagtcagtggagatgaaagatgatgagaagaagcagaatgtggttaat
ggaaagcaagaccttcaagtttaa

DBGET integrated database retrieval system