KEGG   Arabidopsis thaliana (thale cress): AT1G22620Help
Entry
AT1G22620         CDS       T00041                                 

Gene name
ATSAC1
Definition
(RefSeq) Phosphoinositide phosphatase family protein
  KO
K22913  phosphatidylinositol 3,5-bisphosphate 5-phosphatase [EC:3.1.3.-]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00562  Inositol phosphate metabolism
ath01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    AT1G22620 (ATSAC1)
Enzymes [BR:ath01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.-  
     AT1G22620 (ATSAC1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Syja_N WYL
Motif
Other DBs
NCBI-GeneID: 838868
NCBI-ProteinID: NP_173676
MIPS: AT1G22620.1
TAIR: AT1G22620
Araport: AT1G22620
UniProt: Q7XZU3 A0A178WK36
Position
1
AA seq 912 aa AA seqDB search
MAKSENSTTSTFSSFANKIQPSNDAESDPDSYALEKFKLYETRARFYLVGSDRNKRFFRV
LKIDRSEPSELNISEDPVVYSPQEIKSLLQRIAEGNRATGGLAFVAKVYGIAGCAKFMES
YYLVLVTKRRQIGCICGHAIYAIDESQMISVPHATIQSDVANSKTELRYKKLLSSVDLTK
DFFYSYTYPIMQSLQKNVLSSGEEGMPYDNIFVWNSYLTQPIRSRCNNTIWTLALVHGHF
KQIRLSIYGRDFSVTLVSRRSRHFAGTRYLKRGVNDRGRVANDVETEQLVLDDEAGSCKG
KMSSVVQMRGSIPLFWSQEASRFSPKPDIFLQRYDPTYESTKMHFEDLVNRYGNPIIVLN
LIKTVEKRPREMVLRREFANAVGYLNSIFREENHLKFIHWDFHKFAKSKSANVLAVLGAV
ASEALDLTGLYFSGKPKIVKKKASQLSHANTAREPSLRDLRAYSAELSRGESANDILSAL
ANREKEMKLTQQKKDEGTNSSAPRYQSGVLRTNCIDCLDRTNVAQYAYGLAALGRQLHAM
GLSDTPKIDPDSSIAAALMDMYQSMGDALAQQYGGSAAHNTVFPERQGKWKATTQSREFL
KSIKRYYSNTYTDGEKQDAINLFLGYFQPQEGKPALWELDSDYYLHVSGIGDDIFPDIGV
QSIAKPMSGIGVNLAPVPAFRDDFSRKKLTSFDKLIEQTCSSIKNVRLCSETDQRPGGNT
GSTGVAPDAAEIQLKSPNWLFGSRKPEESSSATKSGADDSEKGVTSTERVNDFCNLDWLS
KSDRHQGDIFQRYLSITSTNEANGWYGGTLLGDQDENSEIYRHYAQFCQCPAMEPFENDH
EFEQNFAEVLRMNTIDVMDIEEEETEMESDFNEYTQIGSDLGIIPMQCKHFASDPCWLAR
WLVGDDKVPKVI
NT seq 2739 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaatcggaaaactcaacgacttcgactttctcttctttcgccaacaagattcaa
ccgtccaacgatgcagagtccgatcccgattcgtatgccctcgagaaattcaaactctac
gaaaccagagcgaggttttatctagtagggagtgataggaataaaagattcttcagagtg
ttgaagattgatcgttcagagccatctgagcttaatattagtgaagatcctgttgtatat
tcgcctcaagagatcaagagtctgcttcagcgtatcgctgaaggcaatcgtgccacggga
ggattggcttttgtggccaaagtctatggaattgctggttgtgctaagtttatggagtca
tactatttagttttggttacaaaacggcgacagattggatgtatatgcgggcatgcgata
tatgctattgatgaaagtcaaatgatcagtgttccacatgcaactattcaatctgatgtt
gcgaattccaaaactgaactaaggtacaagaagcttctgtcaagtgtagatttgacaaaa
gatttcttctacagttacacttaccctataatgcaaagcttgcaaaagaatgttctatca
tctggtgaggaagggatgccttatgataacatattcgtatggaattcgtatctgacgcag
cctattcgatcaaggtgcaacaacactatttggacactggcattagttcatgggcacttt
aagcagataagactatcaatatatggaagagacttcagtgttactttagtctccagacgt
tctcgacattttgcaggcacacgttacttgaaaaggggagtgaatgatcgtggaagggtt
gcaaatgatgttgaaacagaacaacttgttcttgatgatgaagctggatcatgcaaagga
aaaatgagctcagtggtgcagatgcgagggtcaattccactcttttggtcacaagaggcc
tccagatttagtcctaagcctgatatcttcttacagaggtatgaccctacatatgagtca
accaaaatgcattttgaagacctggtgaatcgatatgggaatccgatcattgtgctcaac
ttaattaagacagttgagaaaaggccaagggaaatggtgctaagacgtgagtttgcgaat
gctgtgggttatctaaattcaatttttcgtgaagaaaatcatctcaaattcatccactgg
gatttccataaatttgcgaagagcaagtcggcgaatgtattggctgttttgggtgctgta
gcaagcgaagcccttgatttgactggattatatttcagcggcaagcctaaaattgttaag
aagaaggctagccaacttagtcatgctaacactgcaagggaaccttctctgcgtgatcta
agagcttactctgcggaactttcaaggggtgagagtgcaaatgatatacttagtgctctt
gctaatcgagagaaagagatgaagctaacccaacaaaaaaaagacgagggaactaattct
tcagctcctcgttaccaaagtggtgttctgcgtactaactgtatcgattgcttggatcga
acaaatgtagcacagtatgcatatggtttggctgctttaggccggcagctgcatgcaatg
ggtttgagcgatacacctaagatcgaccctgacagtagcatagctgctgcacttatggat
atgtaccagagcatgggagatgcccttgcacaacaatatggcggctcagctgctcataac
actgttttcccagaaaggcaggggaaatggaaggccacgacacagtctagagagtttctc
aagtctatcaaacgatactacagcaatacctacactgatggcgaaaagcaagacgccata
aacttattcttgggctactttcaacctcaggaagggaaacctgcgctctgggagctggat
tctgattactatctccatgtttcagggattggagatgatattttcccagatatcggggtc
cagtccattgctaaacctatgagtggtattggagtcaatcttgcaccagtgccagctttc
agagacgacttctcgcggaagaagctgacatcgtttgacaaactgatagagcagacatgc
agttcaataaagaacgtgaggctttgtagtgagacagaccaaaggccaggtggcaacact
ggaagcactggtgtggctcctgatgcagctgagattcaactcaagagccccaattggctg
tttggttcaagaaagcccgaagagagtagctctgccacaaaatctggtgcagacgatagt
gagaaaggagtaacctcgactgagagagtcaacgatttctgcaacttggactggctttct
aagtccgaccgtcatcaaggagatatcttccaaaggtatctatcgattacatcaaccaat
gaagccaatggttggtatggtggcactctcctcggtgaccaagatgaaaacagcgaaatt
tacagacattacgcccaattctgtcagtgtccagcgatggaaccatttgagaacgatcat
gagtttgaacagaactttgcggaagttctccgcatgaacacaatcgatgtaatggacatt
gaagaagaagaaacggagatggaaagcgatttcaatgaatacactcagatcggtagcgat
ctcgggatcattccaatgcaatgcaaacactttgctagtgatccttgttggctagccaga
tggcttgtcggagatgataaggtcccgaaggtcatttaa

DBGET integrated database retrieval system