KEGG   Arabidopsis thaliana (thale cress): AT1G23740
Entry
AT1G23740         CDS       T00041                                 
Symbol
AOR
Name
(RefSeq) Oxidoreductase, zinc-binding dehydrogenase family protein
  KO
K18980  2-methylene-furan-3-one reductase [EC:1.3.1.105]
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    AT1G23740 (AOR)
Enzymes [BR:ath01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.105  2-methylene-furan-3-one reductase
     AT1G23740 (AOR)
SSDB
Motif
Pfam: ADH_zinc_N_2 ADH_zinc_N ADH_N Methyltransf_25
Other DBs
NCBI-GeneID: 838984
NCBI-ProteinID: NP_173786
TAIR: AT1G23740
UniProt: Q9ZUC1 A0A654ECJ1
Position
1:complement(8398115..8399836)
AA seq 386 aa
MNAALATTTATTPVLRRETPLLHYCSLTTKSPVYQINRVRFGSCVQTVSKKFLKISASSQ
SASAAVNVTADASIPKEMKAWVYSDYGGVDVLKLESNIVVPEIKEDQVLIKVVAAALNPV
DAKRRQGKFKATDSPLPTVPGYDVAGVVVKVGSAVKDLKEGDEVYANVSEKALEGPKQFG
SLAEYTAVEEKLLALKPKNIDFAQAAGLPLAIETADEGLVRTEFSAGKSILVLNGAGGVG
SLVIQLAKHVYGASKVAATASTEKLELVRSLGADLAIDYTKENIEDLPDKYDVVFDAIGM
CDKAVKVIKEGGKVVALTGAVTPPGFRFVVTSNGDVLKKLNPYIESGKVKPVVDPKGPFP
FSRVADAFSYLETNHATGKVVVYPIP
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaacgcagcgcttgcaacaaccaccgccacaactcccgtactccgccgtgagacgcct
cttcttcattattgttctctcacaacaaaatcgccggtttaccaaatcaacagagttaga
ttcggatcttgcgtgcaaacagtcagcaagaaattcttgaaaatctcggcgagctctcag
agcgcttcagcggcggtcaatgtcacggcggatgcttcgattccgaaagagatgaaggcg
tgggtgtatagtgactacggcggagttgatgttctgaagctggagagtaacattgttgtg
ccggagattaaagaagatcaggttttgattaaagttgttgcggcggctcttaatcccgtc
gatgctaagagacggcaagggaaatttaaagccactgattcgcctctcccgactgttccg
ggatacgacgttgccggagtagtggtgaaagtgggaagtgcggtgaaggatttgaaagaa
ggagatgaagtttatgctaacgtgagcgagaaagcattggaaggtccaaagcagtttggt
tctttagcggagtacacggccgtggaagagaagttattagctttaaaacctaaaaacatc
gattttgcgcaagctgcagggcttccgttggcgatagaaaccgctgatgaaggtttagtt
aggactgaattctcagccggaaagtcaattcttgttcttaatggtgccggaggagtaggg
agtcttgtgattcagttggcgaagcacgtgtatggagcttcaaaagtagctgcaactgcg
agtacagaaaagctagagctagtgagaagcttaggtgctgatttagctattgattacaca
aaggagaatatagaagacttgcctgacaagtacgatgttgtctttgacgccattgggatg
tgtgataaggcagtgaaggtgattaaggaaggagggaaagttgtggcattgactggagct
gtcacgcctcctggttttcgattcgttgttacatctaatggcgatgttttgaagaaactt
aacccatatattgagagtgggaaggtgaagcctgtggttgatcccaaaggaccgttccca
ttctcacgcgttgctgatgctttttcatacttagaaacgaaccatgccacagggaaggtc
gttgtttatcccattccttaa

DBGET integrated database retrieval system