KEGG   Arabidopsis thaliana (thale cress): AT1G25270
Entry
AT1G25270         CDS       T00041                                 
Symbol
UMAMIT24
Name
(RefSeq) nodulin MtN21 /EamA-like transporter family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: EamA HNH
Other DBs
NCBI-GeneID: 839110
NCBI-ProteinID: NP_173898
TAIR: AT1G25270
UniProt: Q4PT23
Position
1:8857726..8859909
AA seq 355 aa
MKSVVAMVAVQFIFAGMFILFKITVDDGTNLKVLVAYRLSFATIFMLPLALIFQRKKRPE
FTWRLLLLAFVSGLLGAAIPNILYLPGMARTSATFSAASSIISPLITLVLGLVFRMETLR
LGSNEGRAKLVGTLLGACGALVFVFYKGIEIHIWSTHVDLLKGSHTGRATTNHHVSILGV
LMVLGSNVSTSLWLLLQAKIGKELGGLYWNTSLMNGVGSLVCVIIALCSDHDWEQWQLGW
DINLLATLYSGIVVSGMVVPLVAWCIATKGPLFVTVFSPIRLVIVALIGSFALEEPLHLG
SIIGAMIMVGGVYLVVWCKMKEKKSASTTSDHIETNKNNKELDLGNLSSVNRDVP
NT seq 1068 nt   +upstreamnt  +downstreamnt
atgaagagtgtagttgcaatggtggcggttcagtttatcttcgccgggatgttcattttg
tttaagataacggtcgacgatggtacgaatctcaaagttcttgtagcgtatcgtctgtcc
tttgctactattttcatgcttccccttgccctcatcttccaaaggaagaagcggccagaa
tttacatggaggctgctcttactagcatttgtttcggggttgctcggagcggcgatacca
aatattctctacttgccgggtatggctcgaacatcagcgacattttcagctgcaagcagc
ataattagcccattgatcaccttggtgttgggtttggtgtttaggatggagactctacgg
ctgggatcgaacgaagggagggccaagctagtggggacgctgcttggtgcatgtggagcc
ctcgtgtttgtattctacaaaggtattgagattcatatctggtcaacacacgttgactta
ctcaaaggctcgcatactggtcgagccactacgaaccaccacgtctcaatcttaggggtt
cttatggttcttggcagtaacgtttccacctcactttggttactattgcaggcaaaaata
ggcaaggaacttggaggactttattggaacacaagtttgatgaatggggtgggaagtttg
gtgtgcgtgattattgctctctgttcggatcatgactgggagcaatggcaattaggatgg
gatattaacctcttagctacgctttattcgggaatcgtggtttcgggaatggtcgtgcct
cttgttgcatggtgcatcgcaacaaaaggaccattatttgttactgtctttagccctata
aggctggtgatcgtagccctaataggatcatttgctttagaggaacccctgcatttggga
agtataatcggtgccatgataatggtgggaggagtatacctagtggtatggtgtaaaatg
aaggaaaaaaagagtgcgtctacgacttcggaccatattgaaacaaataagaataacaaa
gaactggaccttggcaatctttcatcagtaaatagagatgtcccctga

DBGET integrated database retrieval system