KEGG   Arabidopsis thaliana (thale cress): AT1G25380
Entry
AT1G25380         CDS       T00041                                 

Gene name
NDT2
Definition
(RefSeq) NAD+ transporter 2
  KO
K15115  solute carrier family 25 (mitochondrial folate transporter), member 32
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G25380 (NDT2)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC25: Mitochondrial carrier
   AT1G25380 (NDT2)
SSDB
Motif
Pfam: Mito_carr DUF4719
Other DBs
NCBI-GeneID: 839124
NCBI-ProteinID: NP_001321077
MIPS: AT1G25380.1
TAIR: AT1G25380
UniProt: Q8RWA5 A0A178WGZ3
Position
1
AA seq 363 aa
MIEHGNSTFDYRSIREVAANAGAGATAGAIAATFVCPLDVIKTRLQVLGLPEAPASGQRG
GVIITSLKNIIKEEGYRGMYRGLSPTIIALLPNWAVYFSVYGKLKDVLQSSDGKLSIGSN
MIAAAGAGAATSIATNPLWVVKTRLMTQGIRPGVVPYKSVMSAFSRICHEEGVRGLYSGI
LPSLAGVSHVAIQFPAYEKIKQYMAKMDNTSVENLSPGNVAIASSIAKVIASILTYPHEV
IRAKLQEQGQIRNAETKYSGVIDCITKVFRSEGIPGLYRGCATNLLRTTPSAVITFTTYE
MMLRFFRQVVPPETNRSDDRRREEERKNLVSRRGEEEDKDLGLRESQTQSNKISTPHIPL
GSK
NT seq 1092 nt   +upstreamnt  +downstreamnt
atgattgaacatgggaactctacctttgattaccggagtattagagaagtcgctgcaaac
gccggcgccggagccaccgcaggggctatcgcggcgacttttgtttgtccattagatgtg
atcaaaacaaggttacaggttcttggtctccctgaagctccagcctctggtcaaagaggt
ggtgtaatcattacaagtctgaagaatataattaaggaagaaggttataggggaatgtat
cgagggctttcaccaaccatcatagctctccttccaaattgggctgtctacttctcagtt
tatgggaagctaaaggatgtgctgcagtcaagtgatggcaagcttagtattgggtcaaac
atgatagctgcagctggtgctggagctgccacatctattgcaactaatccgctttgggtt
gtcaagacaagattaatgacgcaaggaattaggcctggtgtggtaccttacaaaagtgta
atgtctgcatttagtaggatttgtcatgaagaaggagtgcgagggttgtacagtggcata
ttgccttctttggcgggagtaagccatgtcgcgatccagtttccagcttatgaaaaaatt
aagcaatacatggcaaagatggataatacatccgtggagaatctgagtcctgggaatgtt
gctattgcctcctccatcgcgaaagtgatcgcctctattttgacttacccacacgaggta
attagggcgaagcttcaagaacaagggcagattagaaatgctgagactaagtattcagga
gtcattgattgcatcacaaaggtgttcagaagcgaagggattcctgggttgtaccgtgga
tgtgccactaatctactgaggacaactccatcagcagttattacatttacaacctatgag
atgatgcttaggtttttccgacaagttgtgccaccagagactaataggtcggatgatcgc
agaagagaagaagaaagaaagaatttagttagccgacgaggagaagaagaagataaagat
ttgggtttgagagaatcacaaactcaatctaataagatcagcactccccatatccctctt
ggaagcaaataa

DBGET integrated database retrieval system