KEGG   Arabidopsis thaliana (thale cress): AT1G25420Help
Entry
AT1G25420         CDS       T00041                                 

Definition
(RefSeq) Regulator of Vps4 activity in the MVB pathway protein
  KO
K19476  vacuolar protein sorting-associated protein IST1
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04144  Endocytosis
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    AT1G25420
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Ist1
Motif
Other DBs
NCBI-GeneID: 839128
NCBI-ProteinID: NP_001320581
MIPS: AT1G25420.1
TAIR: AT1G25420
Araport: AT1G25420
UniProt: A0A1P8ANA1
Position
1
AA seq 296 aa AA seqDB search
MKLLQNKRDMQLKHMKKEIAHFLQAGQEPIARIRVEHVIREMNLWAAYEILELFCEFILA
RVPILESEKECPRELREAIASIIFAAPRCSEVPDLLQIKNLFGTKYGKEFIMVASELRPD
SGVNRTIIEKLSPTSPSGAARLKMLKEIAQEYSLNWDSSATEAEFMKSHEDLLGGAKQIH
RQDGISESRPSQQGYGQSSVSREVESLPAEATQRFQKLQAQNPVSKSMPSSKLTSAFQAP
PDTRRNQTDVMEIARAALASADRATAAARAAAQLVNVSYGATTPTVAAEGKPLNLM
NT seq 891 nt NT seq  +upstreamnt  +downstreamnt
atgaaattgctgcaaaacaagagagatatgcagcttaaacatatgaagaaggagatagct
cacttcttgcaagctggacaagaacccattgctcgaattcgggtggagcatgtgatcaga
gaaatgaatttatgggcagcttatgagatattggagctattctgcgagtttatacttgct
cgtgttccaattcttgaaagtgaaaaggaatgcccgagagagttgagagaggctattgct
agcattatctttgctgctccaaggtgctctgaagtacctgatcttcttcaaataaagaat
ctgtttggtacaaaatatggaaaagaatttatcatggttgcttctgagcttcgtccggat
tctggtgtcaatcgtactatcattgagaagctttctcctaccagtccatctggagcggca
aggctcaagatgttaaaggaaattgcgcaggagtacagtttgaattgggattcttctgcc
acggaagcagagttcatgaagagccatgaagacctactgggtggagctaagcaaatacat
cgtcaagatggtatctctgaatctcgaccgtcccaacaaggctacggtcagtcttcggtt
tctagggaagttgaaagtctgcctgcagaggccacacagagattccaaaagcttcaagct
caaaacccagtgagcaaaagcatgccatcatctaagctgacttcagcctttcaagctcct
cctgatactagacggaatcagactgatgtaatggagatagctcgagctgccctagctagc
gctgatcgtgcaacagcagctgctcgtgctgctgcgcaactagtgaatgtctcttatggg
gctactacacccacagtagcagcagaagggaagcccttaaacttaatgtag

DBGET integrated database retrieval system