KEGG   Arabidopsis thaliana (thale cress): AT1G26690Help
Entry
AT1G26690         CDS       T00041                                 

Definition
(RefSeq) emp24/gp25L/p24 family/GOLD family protein
  KO
K20352  p24 family protein delta-1
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:ath04131]
    AT1G26690
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G26690
Membrane trafficking [BR:ath04131]
 Endoplasmic reticulum (ER) - Golgi transport
  Forward pathways
   p24 family proteins
    AT1G26690
Transporters [BR:ath02000]
 Other transporters
  Others
   AT1G26690
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: EMP24_GP25L DUF4994
Motif
Other DBs
NCBI-GeneID: 839210
NCBI-ProteinID: NP_564256
MIPS: AT1G26690.1
TAIR: AT1G26690
Araport: AT1G26690
UniProt: Q9LQY3 A0A178WJP9
Position
1
AA seq 214 aa AA seqDB search
MFLRSLNLCTILLFLAISSQVSQSLHFELQSGRTKCISEDIKSNSMTVGKYTVVNPNEAH
PSPQSHKISIRVTSSYGNTYHHAEDVESGQFAFTAVESGDYMACYTAVDHKPEVTLSIDF
DWRTGVQSKSWSSVAKKSQVEVMEFDVKRLIETVNSIHEEMFYLREREEEMQNLNRATNS
KMAWLSFLSLFVCLGVAGMQFVHLKTFFEKKKVI
NT seq 645 nt NT seq  +upstreamnt  +downstreamnt
atgtttctccgatcactcaatctctgtacaatactactcttcctagcgatttcatcacaa
gtttctcaatctctccacttcgaattgcaatctggtcgaacaaaatgtatatcggaagac
ataaaaagcaattcaatgaccgtcgggaagtacaccgtcgttaaccctaacgaagctcat
ccttctcctcaatctcacaagatctccatcagagtgacatcgagttacgggaacacgtat
catcacgcggaagatgtagaatcgggacaattcgcgttcacggcggtggagtctggagat
tacatggcttgttacacagctgttgatcataaacctgaggttacattgagtattgatttc
gattggagaactggtgttcaatctaaaagctggagtagtgttgctaagaagagccaagtc
gaagttatggagtttgatgtaaaaagacttattgaaaccgtcaattcgattcatgaagag
atgttttatctcagagaaagggaagaagagatgcagaatctgaaccgggctactaactcg
aaaatggcgtggttgagtttcctctctcttttcgtatgcttaggagtcgcgggaatgcag
tttgtgcatttgaagacgtttttcgagaagaagaaagtcatctaa

DBGET integrated database retrieval system