KEGG   Arabidopsis thaliana (thale cress): AT1G27030Help
Entry
AT1G27030         CDS       T00041                                 

Definition
(RefSeq) hypothetical protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: DUF1338 SF3a60_bindingd
Motif
Other DBs
NCBI-GeneID: 839592
NCBI-ProteinID: NP_564270
MIPS: AT1G27030.1
TAIR: AT1G27030
Araport: AT1G27030
UniProt: Q9LFY3 A0A178W5X7
Position
1
AA seq 310 aa AA seqDB search
MGSFDLPHSSSFKGESEIFLRNVFENILKTYLRKNPTAKTIWELVQSLDNEKICYDHFTF
RTLKVDGYGIDSLSSFFMAYGYKIGGGLDFPKKKLRVLWFSPPDVHVPNDGHGLGNGPLP
RLVIAEVLVDELSPESQGIIRKYLKQEGGKQAVLSSTLGSLIWEKPTWTDFKQLAKESEF
AAWTLIHGYTMNHLAFAVHRFKHRFSDIKFVKQRLEEKGFKLNSDGEILKVSQDGLLFQV
SSISERLPVTFADGVTETIPASYIEFTQRQVLPEFKDVPLDEIKEFHRREAFELDNANHV
MESTRFTTKF
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgggttccttcgacttgcctcacagttcatcgttcaagggagaaagtgaaatatttctt
cggaatgtgttcgagaatatattgaaaacgtacctaaggaagaacccgacggcgaagaca
atatgggaactggttcagtcgttggacaacgaaaagatctgctacgaccacttcactttc
aggacactaaaggtcgatggttatggaatagactccttgtcgagttttttcatggcttat
ggatataaaattggtggtggacttgattttcccaagaagaaactacgagttctttggttt
tctccacctgatgttcacgttcctaatgatggtcacggtctaggcaacggccctttgccg
cgacttgttatagctgaggttcttgtggacgaactaagccctgaatcacaggggataata
aggaagtatttgaaacaagaaggtggcaagcaagcggttctttctagtactttggggtct
ttaatatgggagaagcctacatggaccgacttcaagcagcttgccaaagaaagcgaattt
gcggcatggacgcttatccacggctacacaatgaatcatcttgcttttgcggttcatcga
ttcaaacatcgtttcagtgacatcaaattcgtcaaacagcgtcttgaggaaaagggattc
aaactcaacagtgacggagaaatcctcaaagtgagtcaagatggtctactatttcaagtt
tcatcgatctcggaaaggcttccggtaacatttgcagatggagtaactgaaacaatccca
gcttcatacattgaattcactcagcgtcaagttcttccagagttcaaagatgtgccgctt
gatgagatcaaagaatttcatagacgtgaagcttttgaactcgataacgccaaccacgta
atggaaagcacccgtttcacaactaaattctag

DBGET integrated database retrieval system