KEGG   Arabidopsis thaliana (thale cress): AT1G27320Help
Entry
AT1G27320         CDS       T00041                                 

Gene name
HK3
Definition
(RefSeq) histidine kinase 3
  KO
K14489  arabidopsis histidine kinase 2/3/4 (cytokinin receptor) [EC:2.7.13.3]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04075 Plant hormone signal transduction
    AT1G27320 (HK3)
Enzymes [BR:ath01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.13  Protein-histidine kinases
    2.7.13.3  histidine kinase
     AT1G27320 (HK3)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: CHASE HATPase_c Response_reg HisKA ELO PIG-P
Motif
Other DBs
NCBI-GeneID: 839621
NCBI-ProteinID: NP_564276
MIPS: AT1G27320.1
TAIR: AT1G27320
Araport: AT1G27320
UniProt: Q9C5U1 A0A178WL02
Position
1
AA seq 1036 aa AA seqDB search
MSLFHVLGFGVKIGHLFWMLCCWFVSWFVDNGIEDKSGLLVGSVGDLEKTKMTTLKKKNK
MWFWNKISSSGLKIPSFSYQFLGSVKFNKAWWRKLVVVWVVFWVLVSIWTFWYFSSQAME
KRKETLASMCDERARMLQDQFNVSMNHVQAMSILISTFHHGKIPSAIDQRTFSEYTDRTS
FERPLTSGVAYAMRVLHSEREEFERQQGWTIRKMYSLEQNPVHKDDYDLEALEPSPVQEE
YAPVIFAQDTVSHVVSLDMLSGKEDRENVLRARSSGKGVLTAPFPLIKTNRLGVILTFAV
YKRDLPSNATPKERIEATNGYLGGVFDIESLVENLLQQLASKQTILVNVYDITNHSQPIS
MYGTNVSADGLERVSPLIFGDPLRKHEMRCRFKQKPPWPVLSMVTSFGILVIALLVAHII
HATVSRIHKVEEDCDKMKQLKKKAEAADVAKSQFLATVSHEIRTPMNGVLGMLHMLMDTE
LDVTQQDYVRTAQASGKALVSLINEVLDQAKIESGKLELEEVRFDLRGILDDVLSLFSSK
SQQKGVELAVYISDRVPDMLIGDPGRFRQILTNLMGNSIKFTEKGHIFVTVHLVDELFES
IDGETASSPESTLSGLPVADRQRSWENFKAFSSNGHRSFEPSPPDINLIVSVEDTGVGIP
VEAQSRIFTPFMQVGPSISRTHGGTGIGLSISKCLVGLMKGEIGFSSTPKVGSTFTFTAV
FSNGMQPAERKNDNNQPIFSEFRGMKAVVVDHRPARAKVSWYHFQRLGIRVEVVPRVEQA
LHYLKIGTTTVNMILIEQEIWNREADDFIKKLQKDPLFLSPKLILLANSVESSISEALCT
GIDPPIVIVKPLRASMLAATLQRGLGIGIREPPQHKGPPALILRNLLLGRKILIVDDNNV
NLRVAAGALKKYGADVVCAESGIKAISLLKPPHEFDACFMDIQMPEMDGFEATRRIRDME
EEMNKRIKNGEALIVENGNKTSWHLPVLAMTADVIQATHEECLKCGMDGYVSKPFEAEQL
YREVSRFFNSPSDTES
NT seq 3111 nt NT seq  +upstreamnt  +downstreamnt
atgagtctgttccatgtgctagggtttggtgtcaagattgggcatctcttctggatgcta
tgctgctggtttgtttcttggttcgttgataatgggatcgaggacaagtctggtctttta
gttggctctgtcggtgatcttgagaagactaagatgactacgttgaagaagaagaacaag
atgtggttctggaataagatctctagcagcggactcaagatcccgagtttctcttatcag
tttcttggctctgttaaattcaacaaggcgtggtggaggaagcttgtggtggtttgggtt
gtcttctgggtcttggtctctatttggacgttttggtactttagctcgcaagctatggag
aagaggaaagagacgctagctagtatgtgtgatgagagagctcgtatgctgcaggatcag
ttcaacgttagcatgaatcatgttcaagccatgtctatcttgatctcaaccttccaccat
ggcaagattccttctgctatcgatcagagaacattctcagagtacactgatagaacttcc
tttgagaggcctcttactagcggggtagcttatgctatgagggtgctccattcagagagg
gaagagttcgagaggcaacaaggttggactattaggaagatgtattctcttgaacaaaac
ccagttcacaaggatgactatgacctggaagctttggaaccatcccctgtccaagaagag
tacgctccagtcatctttgctcaggacactgtttctcacgttgtttctctcgatatgctg
tctgggaaagaagatcgtgaaaacgttttgcgggccaggagttcaggtaaaggggttttg
acagctcctttcccattgataaagacaaatagacttggggtgatcctgacatttgcagtg
tacaagagagatctcccctccaatgcaacgccaaaagagagaattgaggctactaacggg
tatctcgggggagtgtttgacattgagtccctggtagaaaacttgcttcaacagctggct
agcaagcaaacgattcttgtcaatgtgtacgatatcaccaatcactctcaaccgattagc
atgtatggtacaaatgtgtcggctgatgggttggaacgtgttagtccactaatctttggc
gatccattgagaaagcatgagatgcgttgcagatttaagcagaaaccaccatggccagtg
ctatcaatggtgacatcattcggtatccttgtgattgcgttacttgttgcacatataatc
cacgcaaccgttagtcgaatacacaaagttgaagaagattgtgataaaatgaagcagctc
aagaaaaaggctgaagcagcagatgttgcaaagtcacagttccttgccactgtttcacat
gaaatcagaactccaatgaatggtgttctaggaatgttgcatatgcttatggacacagag
ttagatgttacgcaacaggattatgttaggaccgcacaggcaagtggaaaagctttagtc
tcgctaataaatgaggttttggaccaagcaaagattgaatctggaaagcttgaacttgag
gaggtgcggtttgatttgagaggaatattagatgatgtcctgtcactcttctctagcaag
tcccaacaaaagggggtggagttggcagtatacatatctgatcgtgttccagatatgtta
attggtgatcctgggaggtttcgacaaatactcacaaatcttatgggtaattccattaag
ttcactgagaaaggacacatctttgtaactgttcatttggtggatgagctatttgaatct
atcgatggagagacagcatcatctccggaaagtacactgagtgggcttccagttgcagac
cggcagaggagctgggaaaactttaaagctttcagctccaacgggcatcggagctttgaa
ccatctccccctgatataaacctaatcgtctcagttgaggatactggcgtagggatccct
gtagaagcgcagtcccgtatttttacgcctttcatgcaagtcggaccatccatatccagg
acgcatggaggcacaggaattggacttagcataagcaaatgtctagttggactgatgaag
ggagaaattggattctcgagtactcccaaggttgggtccacattcacatttactgctgta
ttttccaatgggatgcaaccagctgaaagaaagaatgacaacaaccagcccatattctcg
gaattccggggcatgaaagctgtggttgtggaccataggcctgcaagggcaaaagtctcg
tggtaccattttcagcgtcttggaattcgagtcgaagtagttccacgtgttgaacaggct
ctacattatctgaagattggtactaccactgtgaatatgatactcatagagcaagaaata
tggaatagggaagcagatgatttcattaaaaagctacagaaagaccctcttttcctttct
cctaagttgattttgttagcaaactcagtagaatcgtcaatatcagaggctttatgcacc
ggtatagatcctccaatagtgatagtgaaaccattgagggcgagtatgctagcagcaact
ttgcagaggggattgggtattggaatcagagaaccacctcaacacaagggacctcctgct
ttgattctcaggaatcttctccttggtagaaaaattttaatcgtggatgataacaacgta
aacctcagagtggcagcgggagctctgaaaaagtacggagctgatgtggtctgcgctgag
agtgggataaaggcaatctcattgcttaagccacctcacgagtttgatgcttgcttcatg
gacattcagatgccagaaatggatggatttgaagctacaaggagaatacgagatatggaa
gaggagatgaacaagagaataaagaatggggaggctttgatagtagagaacggtaacaaa
acaagctggcatcttccggtattagcaatgacggcagatgtgatccaagcaacgcatgag
gaatgtctgaagtgtggaatggatgggtatgtatcaaaaccatttgaagcagagcagctg
tacagggaagtttctcgctttttcaattcgccttcagatacagaatcataa

DBGET integrated database retrieval system