KEGG   Arabidopsis thaliana (thale cress): AT1G29260
Entry
AT1G29260         CDS       T00041                                 
Symbol
PEX7
Name
(RefSeq) peroxin 7
  KO
K13341  peroxin-7
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:ath00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    AT1G29260 (PEX7)
SSDB
Motif
Pfam: WD40 NBCH_WD40
Other DBs
NCBI-GeneID: 839800
NCBI-ProteinID: NP_174220
TAIR: AT1G29260
UniProt: Q9XF57 A0A178WDC3
Position
1:10224815..10226322
AA seq 317 aa
MPVFKAPFNGYSVKFSPFYESRLAVATAQNFGILGNGRIHVLELAPGAPGVTESVSYDTA
DAVYDVCWSESHDSVLIAAIGDGSVKIYDTALPPPSNPIRSFQEHAREVQSVDYNPTRRD
SFLTSSWDDTVKLWAMDRPASVRTFKEHAYCVYQAVWNPKHGDVFASASGDCTLRIWDVR
EPGSTMIIPAHDFEILSCDWNKYDDCILATSSVDKTVKVWDVRSYRVPLAVLNGHGYAVR
KVKFSPHRRSLIASCSYDMSVCLWDYMVEDALVGRYDHHTEFAVGIDMSVLVEGLMASTG
WDELVYVWQQGMDPRAS
NT seq 954 nt   +upstreamnt  +downstreamnt
atgccggtgttcaaagctccgttcaatggctactctgtgaaattcagtccattctacgag
tcacgcctcgccgtcgctacagctcagaacttcggaattctcggaaacggccgaatccat
gtcctcgagctcgctcctggagctccaggcgtaactgaatccgtctcgtacgatacagcc
gacgctgtatacgacgtatgttggtcagaatctcatgactctgtgctcatcgccgcaatt
ggtgacggctcagtgaagatttacgacacagctcttcctcctccttctaatccgattaga
tcattccaagagcacgcgcgtgaggttcaatctgtggattacaatcccacgcggcgcgat
tcgtttctcacttcttcgtgggatgatacggttaagctttgggctatggatcgtccggcg
agtgtaaggacttttaaggaacatgcttattgcgtttatcaagcagtttggaatcctaaa
catggtgatgtgtttgcttctgcttctggagattgtactttaaggatttgggatgttaga
gaacctggatcaactatgatcatccctgctcatgattttgagattttgtcttgtgattgg
aataagtatgatgattgtattttagctacttcttcagtggataagacagttaaggtttgg
gatgttaggagttatagagttcctttggctgtgcttaatggtcatggatatgcggtgagg
aaggtgaaattctcgccgcataggaggagtttgatagcttcttgctcttatgatatgagt
gtttgtctttgggactatatggtggaagatgctttggttggtaggtatgatcatcataca
gagtttgctgttgggatcgatatgagtgttcttgttgaaggtttaatggcgagtactggt
tgggatgagcttgtttatgtttggcagcaagggatggatcctagagccagttga

DBGET integrated database retrieval system