KEGG   Arabidopsis thaliana (thale cress): AT1G29550Help
Entry
AT1G29550         CDS       T00041                                 

Definition
(RefSeq) Eukaryotic initiation factor 4E protein
  KO
K03259  translation initiation factor 4E
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath03013  RNA transport
Module
ath_M00428  eIF4F complex
Brite
KEGG Orthology (KO) [BR:ath00001]
 Genetic Information Processing
  Translation
   03013 RNA transport
    AT1G29550
Messenger RNA biogenesis [BR:ath03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     AT1G29550
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     AT1G29550
Translation factors [BR:ath03012]
 Eukaryotic Type
  Initiation factors
   eIF-4
    AT1G29550
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: IF4E
Motif
Other DBs
NCBI-GeneID: 839832
NCBI-ProteinID: NP_174248
MIPS: AT1G29550.1
TAIR: AT1G29550
Araport: AT1G29550
UniProt: Q9C7P6 A0A178W1I7
Position
1
AA seq 240 aa AA seqDB search
MVVTDSPVSGIMADQNIDPNTTTSPSPKEKHVSAIKAISGDEKAPSKEKKNYASKKSTTV
IQKSHCFQNSWTFWFDNPSSKSNQVIWGSSLRSLYTFGTIEEFWSLYNNIHPPTKWVSGA
DLYCFKDKIEPKWEDPICANGGKWSMMFPKATLECNWLNTLLALVGEQFDQGDEICGAVL
NFRARGDRISLWTKNAANEEAQLSIGKQWKELLGYNETIGFIVHEDAKTLDRDAKRRYTV
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atggtggttacggattctccagtttcggggataatggctgatcagaacatcgatcctaac
accacgacgagccctagtcctaaagagaagcatgtttctgcgattaaggctatctccggc
gacgagaaagctccgtcgaaggagaaaaagaactacgcgtcgaagaaatcaactaccgta
atccagaaatcgcactgtttccagaattcttggacattttggttcgataatccttcctcc
aaatcgaatcaagtcatatggggaagctctttgagatccttgtatacattcggtactatc
gaagagttctggagtctctacaataacattcatcctccaaccaagtgggtttcgggggcg
gatctttactgcttcaaagataagattgaaccaaaatgggaagatcctatctgtgctaat
ggaggaaaatggagtatgatgttccctaaagctacactagaatgcaattggcttaacacg
ttacttgcgttggttggtgagcaatttgaccaaggagatgagatctgtggagcagttttg
aacttcagagcgagaggggacaggatctctctatggacaaagaacgctgcaaatgaggag
gctcagctaagcattgggaagcagtggaaggaacttcttggctacaatgagacaatcgga
tttatagttcatgaggatgcaaagactcttgatcgtgatgctaaacgtcgatatactgta
tga

DBGET integrated database retrieval system