KEGG   Arabidopsis thaliana (thale cress): AT1G29570
Entry
AT1G29570         CDS       T00041                                 

Definition
(RefSeq) Zinc finger C-x8-C-x5-C-x3-H type family protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: zf-CCCH zf-CCCH_2 zf-CCCH_4 zf_CCCH_4
Other DBs
NCBI-GeneID: 839834
NCBI-ProteinID: NP_174250
MIPS: AT1G29570.1
TAIR: AT1G29570
UniProt: Q9C7P4
Position
1
AA seq 321 aa
MADAGDNQQEAERRSDETESRSIKEPKEKEDEDENPQDQIQSKERMRQSSPYPVRPGKKD
CQFYLKNGLCRYRSSCRFNHPTQRPQELPVRICKHIMDRNVAEPMYQDWRESESERRFDE
RTQRTFGDERTQRRYGIEYSGARPEKRSKIVPDFQMRDPRHHDTEWRFERERMERIERQR
REAEENLQEQRQRDSIERQRREAEENLQEQRQRDSIERQRREAQENLQQQRQRDSIERQR
REAQENLQQQRLQDMPENHNVDDQQNLQEQRRISIEKERTEARLRLEQIRPTVSFPINEF
IRAVVLLRELIENWDDKAWKK
NT seq 966 nt   +upstreamnt  +downstreamnt
atggcagacgctggagataatcagcaagaagctgagagaagaagcgatgaaacagagtcg
agatccattaaagaaccgaaggagaaagaagacgaagatgagaatcctcaggatcaaata
cagagcaaagagaggatgaggcagtcgagtccgtatccagttcgtcccggtaaaaaagac
tgtcagttttacctcaaaaatggtctgtgtcgctatagaagtagttgccgtttcaatcat
cctactcaacgtccacaagagcttccggtgaggatttgtaagcacattatggacagaaat
gttgcagagcctatgtatcaggattggagagagagtgaatcagaacggagatttgatgag
agaactcagcgcacatttggtgatgagagaactcaaagaagatatggaatagagtactca
ggagccaggccagagaagaggtccaagattgttccggattttcaaatgcgtgatccaaga
caccatgatacagagtggagattcgagcgagagaggatggaacgaattgaaaggcagagg
agagaggctgaagaaaatctgcaagaacagagacagagagatagcattgagaggcagagg
agagaggctgaagaaaatctgcaagaacagagacagagagatagcattgagaggcagagg
agagaggctcaagagaatctgcaacaacagagacagagagatagcattgagaggcagagg
agagaggctcaagagaatctgcaacaacagagattacaggacatgccagagaatcacaac
gtagatgatcaacagaatctgcaggaacagagacggataagcattgagaaggagagaaca
gaagctcgtttgagactagaacagatccgacccactgtttcatttccaataaacgaattt
attcgagccgtagtgttgctgagagaactgatagagaattgggatgataaagcttggaag
aaatag

DBGET integrated database retrieval system