KEGG   Arabidopsis thaliana (thale cress): AT1G29900
Entry
AT1G29900         CDS       T00041                                 
Symbol
CARB
Name
(RefSeq) carbamoyl phosphate synthetase B
  KO
K01955  carbamoyl-phosphate synthase large subunit [EC:6.3.5.5]
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath00220  Arginine biosynthesis
ath00240  Pyrimidine metabolism
ath00250  Alanine, aspartate and glutamate metabolism
ath01100  Metabolic pathways
ath01240  Biosynthesis of cofactors
Brite
KEGG Orthology (KO) [BR:ath00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00240 Pyrimidine metabolism
    AT1G29900 (CARB)
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AT1G29900 (CARB)
   00220 Arginine biosynthesis
    AT1G29900 (CARB)
Enzymes [BR:ath01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.5  carbamoyl-phosphate synthase (glutamine-hydrolysing)
     AT1G29900 (CARB)
SSDB
Motif
Pfam: CPSase_L_D2 CPSase_L_D3 MGS Dala_Dala_lig_C ATP-grasp ATP-grasp_4 ATPgrasp_Ter ATP-grasp_2 ATP-grasp_5 Epimerase CoA_binding_2
Other DBs
NCBI-GeneID: 839868
NCBI-ProteinID: NP_564338
TAIR: AT1G29900
UniProt: Q42601 A0A5S9WFA7
Position
1:10467956..10472211
AA seq 1187 aa
MRNHCLELSSNCSSIFASSKSNPRFSPSKLSYSTFFSRSAIYYRSKPKQASSSSSFSTFP
PCLNRKSSLTHVLKPVSELADTTTKPFSPEIVGKRTDLKKIMILGAGPIVIGQACEFDYS
GTQACKALREEGYEVILINSNPATIMTDPETANRTYIAPMTPELVEQVIEKERPDALLPT
MGGQTALNLAVALAESGALEKYGVELIGAKLGAIKKAEDRELFKDAMKNIGLKTPPSGIG
TTLDECFDIAEKIGEFPLIIRPAFTLGGTGGGIAYNKEEFESICKSGLAASATSQVLVEK
SLLGWKEYELEVMRDLADNVVIICSIENIDPMGVHTGDSITVAPAQTLTDREYQRLRDYS
IAIIREIGVECGGSNVQFAVNPVDGEVMIIEMNPRVSRSSALASKATGFPIAKMAAKLSV
GYTLDQIPNDITRKTPASFEPSIDYVVTKIPRFAFEKFPGSQPLLTTQMKSVGESMALGR
TFQESFQKALRSLECGFSGWGCAKIKELDWDWDQLKYSLRVPNPDRIHAIYAAMKKGMKI
DEIYELSMVDKWFLTQLKELVDVEQYLMSGTLSEITKEDLYEVKKRGFSDKQIAFATKTT
EEEVRTKRISLGVVPSYKRVDTCAAEFEAHTPYMYSSYDVECESAPNNKKKVLILGGGPN
RIGQGIEFDYCCCHTSFALQDAGYETIMLNSNPETVSTDYDTSDRLYFEPLTIEDVLNVI
DLEKPDGIIVQFGGQTPLKLALPIKHYLDKHMPMSLSGAGPVRIWGTSPDSIDAAEDRER
FNAILDELKIEQPKGGIAKSEADALAIAKEVGYPVVVRPSYVLGGRAMEIVYDDSRLITY
LENAVQVDPERPVLVDKYLSDAIEIDVDTLTDSYGNVVIGGIMEHIEQAGVHSGDSACML
PTQTIPASCLQTIRTWTTKLAKKLNVCGLMNCQYAITTSGDVFLLEANPRASRTVPFVSK
AIGHPLAKYAALVMSGKSLKDLNFEKEVIPKHVSVKEAVFPFEKFQGCDVILGPEMRSTG
EVMSISSEFSSAFAMAQIAAGQKLPLSGTVFLSLNDMTKPHLEKIAVSFLELGFKIVATS
GTAHFLELKGIPVERVLKLHEGRPHAADMVANGQIHLMLITSSGDALDQKDGRQLRQMAL
AYKVPVITTVAGALATAEGIKSLKSSAIKMTALQDFFEVKNVSSLLV
NT seq 3564 nt   +upstreamnt  +downstreamnt
atgagaaaccattgcttagaactctcttccaattgttcctccattttcgcttcttccaaa
tccaatcctcgtttctctccttccaagctctcctattccactttcttctctcgctctgcc
atctattacagatcaaaaccaaaacaagcctcgtcttcttcttccttctccactttcccc
ccatgtctcaatcggaaaagctccctcacgcatgttctcaaacccgtctcagagctcgcc
gacaccactaccaagcctttttctccggagatcgtcggcaagagaaccgatctgaagaag
attatgattctcggcgctggtccgattgtcattggacaagcttgtgagtttgattactct
ggtactcaagcttgtaaagccttaagagaagagggctatgaggttatcctgatcaattcg
aatcctgccactatcatgactgatccggaaactgctaatcggacttatatcgctccgatg
actcctgagcttgtcgagcaggttattgagaaagagaggcctgacgctttgttaccaacc
atgggtggtcaaaccgcattgaacctcgcggttgctcttgctgagagtggtgctttggag
aaatacggtgttgaattgataggagctaagcttggtgcgattaagaaagctgaagatcgt
gagttgttcaaggatgcgatgaagaacattgggctaaagactccaccttcagggattggg
accactcttgatgagtgttttgacattgctgagaaaattggtgagttccctttgattatc
cgtcctgcgtttactttaggtggtactggtggtggaattgcgtataacaaagaggagttt
gagtctatatgtaaatcgggtttggctgcgagtgcgacaagtcaagttcttgtggagaaa
tccttgttgggttggaaagaatatgagcttgaggtgatgagagacttagctgacaatgtt
gtcattatctgttccattgagaatattgatcctatgggtgtgcacactggtgattccatc
actgtggcacctgcacagactctaacggatagagagtaccagcggcttagggattattcc
attgcgattatacgggagattggtgttgagtgtggtggatctaatgtgcagtttgctgtc
aacccggttgatggtgaagttatgatcatagagatgaaccctagggtctcaagatcttct
gctcttgcttccaaggctacagggtttcccattgctaaaatggctgccaagttgtctgtt
ggctataccttggatcagattcctaatgatatcacgaggaaaacaccggctagcttcgag
ccctccatcgattatgtggtgactaagattcctcgatttgcatttgaaaagtttccagga
tctcagccattgctaacgacccagatgaaatctgttggggaatctatggctctcggccgt
acattccaagaatctttccagaaagctctgaggtctctggagtgtggattctcgggttgg
ggttgtgcaaaaattaaagagctagattgggactgggatcagctgaaatacagcctaaga
gtcccaaatcctgacaggatccatgcgatatatgctgccatgaaaaagggtatgaaaatt
gatgaaatctacgagttgagcatggtggacaagtggttcctaacccagcttaaagagctc
gtggacgtcgaacagtatcttatgtccggaaccttgtcagagattacaaaagaagacctt
tacgaagtcaaaaagcggggatttagtgacaagcaaatcgcttttgctacaaagacaacc
gaggaagaagtccgtaccaagcggatttctctaggagttgttccatcttacaagagagtg
gatacatgtgctgcagagttcgaagcgcatacaccatacatgtactcttcatatgatgtt
gaatgtgaatcagctccaaacaacaagaagaaggttttgattttgggtggagggccaaac
cgcattggtcaagggattgaatttgattactgttgttgccacacatctttcgccttacag
gatgctggatatgagaccataatgttgaactcaaatcctgaaacagtatccacagattat
gatacaagcgataggctctattttgaacctctcacaatcgaggatgttctcaatgttatc
gaccttgagaaacctgatggcataatagtgcaatttggtggtcaaactcctctgaaactt
gctctgccgatcaaacattatttggataagcacatgcccatgagcttgagcggagcggga
cctgttcgcatctggggtacatcacctgactccattgacgctgctgaagacagagagagg
ttcaatgcaattctcgacgagctgaagattgagcagcccaagggaggcattgcaaagagc
gaagctgatgcattagccatagcaaaggaggtagggtacccagttgtggtaagaccttct
tatgttctaggtggacgagcaatggagatcgtttatgatgacagtagactaataacctat
ttggaaaatgcggtacaagttgacccagagagacctgttttggtagataaatatctttct
gatgccattgagatcgacgttgatacccttactgattcctatggaaatgtggtgattggt
ggaataatggagcatatcgaacaagctggtgtgcattctggtgactcagcttgtatgctt
ccaacacaaaccatcccagcttcttgtttgcaaactattcgaacatggaccactaagctg
gcgaagaagctaaatgtatgtgggctgatgaactgtcagtacgcaatcacaacatctggg
gatgtttttttgctggaagccaatccccgagcttcccgtactgtcccttttgtgtcaaaa
gccattggacaccctcttgccaagtatgcagcgctggtcatgtcgggcaaatctctcaaa
gatcttaactttgaaaaagaagttatccctaaacatgtctctgtgaaagaagctgttttc
ccgtttgagaagttccaaggatgcgatgtgatactcgggccagagatgagaagcacagga
gaagtgatgagcatcagttctgaattctcaagtgcgtttgcaatggctcagatcgctgca
ggtcaaaagctacctctatcaggcacagtcttcctcagcttaaacgatatgaccaaaccg
cacctggagaaaatcgcggtgtccttcctcgagcttgggttcaaaatagttgccacctcg
ggaacagctcatttcctggaactgaaaggcattccagtggagagagtgttgaagttgcat
gaaggaagaccacatgctgctgatatggtggcgaatggtcagatccatttgatgttgatc
acaagctcgggtgatgctcttgatcagaaagatgggagacagctcagacaaatggctcta
gcatacaaggtacctgttataaccactgttgctggtgcattggccactgctgagggaatc
aagagcttgaagtcaagtgccattaaaatgaccgctcttcaggacttctttgaggtaaag
aatgtatcttctttgctcgtctga

DBGET integrated database retrieval system