KEGG   Arabidopsis thaliana (thale cress): AT1G30220
Entry
AT1G30220         CDS       T00041                                 

Symbol
INT2
Name
(RefSeq) inositol transporter 2
  KO
K08150  MFS transporter, SP family, solute carrier family 2 (myo-inositol transporter), member 13
Organism
ath  Arabidopsis thaliana (thale cress)
Brite
KEGG Orthology (KO) [BR:ath00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:ath02000]
    AT1G30220 (INT2)
Transporters [BR:ath02000]
 Solute carrier family (SLC)
  SLC2: Facilitative GLUT transporter
   AT1G30220 (INT2)
 Major facilitator superfamily (MFS)
  Sugar transporters
   Sugar porter (SP) family [TC:2.A.1.1]
    AT1G30220 (INT2)
SSDB
Motif
Pfam: Sugar_tr MFS_1 TRI12
Other DBs
NCBI-GeneID: 839902
NCBI-ProteinID: NP_174313
TAIR: AT1G30220
UniProt: Q9C757
Position
1:complement(10632720..10635581)
AA seq 580 aa
MEGGIIHGGADESAFKECFSLTWKNPYVLRLAFSAGIGGLLFGYDTGVISGALLYIRDDF
KSVDRNTWLQEMIVSMAVAGAIVGAAIGGWANDKLGRRSAILMADFLFLLGAIIMAAAPN
PSLLVVGRVFVGLGVGMASMTAPLYISEASPAKIRGALVSTNGFLITGGQFLSYLINLAF
TDVTGTWRWMLGIAGIPALLQFVLMFTLPESPRWLYRKGREEEAKAILRRIYSAEDVEQE
IRALKDSVETEILEEGSSEKINMIKLCKAKTVRRGLIAGVGLQVFQQFVGINTVMYYSPT
IVQLAGFASNRTALLLSLVTAGLNAFGSIISIYFIDRIGRKKLLIISLFGVIISLGILTG
VFYEAATHAPAISSLETQRFNNISCPDYKSAMNTNAWDCMTCLKASSPSCGYCSSPIGKE
HPGACWISDDSVKDLCHNENRLWYTRGCPSNFGWFALLGLGLYIIFFSPGMGTVPWIVNS
EIYPLRFRGICGGIAATANWISNLIVAQSFLSLTEAIGTSWTFLIFGVISVIALLFVMVC
VPETKGMPMEEIEKMLERRSMEFKFWKKKSKLVEKQNQSA
NT seq 1743 nt   +upstreamnt  +downstreamnt
atggagggaggaataatacatggaggagcagatgaatcagctttcaaagaatgtttctct
ctaacatggaagaatccttatgttcttcgtcttgctttctctgccggaatcggtggtctt
ctctttggttacgacaccggagtgatatcaggtgctctgctttatatcagagatgatttc
aagtctgttgacagaaatacttggttacaggagatgatagtgagcatggcagttgcagga
gccatcgttggagccgccataggaggttgggcgaacgacaaattagggaggagaagcgcg
attctcatggcggatttcctctttttattaggagctatcattatggcggctgctcctaac
ccgtccctccttgtcgttggccgtgtttttgtgggcctcggggtcgggatggcctcgatg
accgctcctctatacatctcagaagcttcgcctgctaagatcagaggagctttggtcagt
actaatgggtttctcattaccggaggacagttcttgtcttacctcataaacttagccttt
actgatgtgaccggaacgtggagatggatgctcggaatcgccggaattccagctctttta
cagtttgtcttaatgtttacactcccggagtcacctcgatggttataccgcaagggaaga
gaagaagaggctaaagcgattctaagaagaatatactcagcagaagatgtagaacaagag
atacgtgcacttaaagactcagttgaaacagagatacttgaagaagggtcttccgagaaa
atcaacatgatcaaactatgcaaagctaaaaccgttagacgaggactaatagctggtgtt
ggtctccaagtgtttcaacagttcgttgggatcaacacagttatgtattacagtccaacc
attgttcagcttgccggtttcgcttcaaacagaacagctcttctcttgtctctagttacc
gcaggacttaatgcatttggttctataattagcatttacttcattgatagaatcggaagg
aaaaagcttttgatcattagccttttcggagtcattatctcgctaggaatactaaccggt
gttttttatgaagcggctactcacgctcctgcgattagctcactcgagacacaaaggttc
aataatattagttgtccggattataagtcagctatgaataccaatgcttgggattgtatg
acttgtttgaaagcttcttctccatcttgtggctattgttcctctcccattggaaaggaa
catcccggggcatgttggatctctgatgattcggttaaggacttatgtcataacgaaaac
cggctttggtacacgagaggatgtcctagcaattttggttggtttgctcttcttggattg
ggactttatatcatcttcttctctcctggaatggggactgttccatggatagttaactca
gagatttatccattgagattcagaggaatatgtggaggaatagctgcaactgcaaattgg
atatcaaatttgattgtggctcaatcttttttgtcattgaccgaagctattgggacttct
tggacttttctcatctttggagtgatctcagtcattgctcttctctttgttatggtttgt
gttccggagacaaaaggaatgccaatggaggagattgagaagatgcttgaacgaagatcg
atggagtttaagttttggaagaaaaaatcaaaacttgttgagaaacaaaaccagagtgca
tga

DBGET integrated database retrieval system