KEGG   Arabidopsis thaliana (thale cress): AT1G30400
Entry
AT1G30400         CDS       T00041                                 

Gene name
ABCC1
Definition
(RefSeq) multidrug resistance-associated protein 1
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB
Motif
Pfam: ABC_membrane ABC_tran SMC_N MMR_HSR1 RsgA_GTPase Dynamin_N AAA_16 AAA_29 AAA_21 T2SSE DUF87 TrwB_AAD_bind AAA_23
Other DBs
NCBI-GeneID: 839920
NCBI-ProteinID: NP_001031116
MIPS: AT1G30400.1
TAIR: AT1G30400
UniProt: Q9C8G9 A0A178WBV0
Position
1
AA seq 1622 aa
MGFEPLDWYCKPVPNGVWTKTVDYAFGAYTPCAIDSFVLGISHLVLLILCLYRLWLITKD
HKVDKFCLRSKWFSYFLALLAAYATAEPLFRLVMRISVLDLDGAGFPPYEAFMLVLEAFA
WGSALVMTVVETKTYIHELRWYVRFAVIYALVGDMVLLNLVLSVKEYYGSFKLYLYISEV
AVQVAFGTLLFVYFPNLDPYPGYTPVGTENSEDYEYEELPGGENICPERHANLFDSIFFS
WLNPLMTLGSKRPLTEKDVWHLDTWDKTETLMRSFQKSWDKELEKPKPWLLRALNNSLGG
RFWWGGFWKIGNDCSQFVGPLLLNELLKSMQLNEPAWIGYIYAISIFVGVVLGVLCEAQY
FQNVMRVGYRLRSALIAAVFRKSLRLTNEGRKKFQTGKITNLMTTDAESLQQICQSLHTM
WSAPFRIIVALVLLYQQLGVASIIGALFLVLMFPIQTVIISKTQKLTKEGLQRTDKRIGL
MNEVLAAMDTVKCYAWENSFQSKVQTVRDDELSWFRKAQLLSAFNMFILNSIPVLVTVVS
FGVFSLLGGDLTPARAFTSLSLFSVLRFPLFMLPNIITQMVNANVSLNRLEEVLSTEERV
LLPNPPIEPGQPAISIRNGYFSWDSKADRPTLSNINLDIPLGSLVAVVGSTGEGKTSLIS
AMLGELPARSDATVTLRGSVAYVPQVSWIFNATVRDNILFGAPFDQEKYERVIDVTALQH
DLELLPGGDLTEIGERGVNISGGQKQRVSMARAVYSNSDVCILDDPLSALDAHVGQQVFE
KCIKRELGQTTRVLVTNQLHFLSQVDKILLVHEGTVKEEGTYEELCHSGPLFQRLMENAG
KVEDYSEENGEAEVDQTSVKPVENGNANNLQKDGIETKNSKEGNSVLVKREERETGVVSW
KVLERYQNALGGAWVVMMLVICYVLTQVFRVSSSTWLSEWTDSGTPKTHGPLFYNIVYAL
LSFGQVSVTLINSYWLIMSSLYAAKKMHDAMLGSILRAPMVFFQTNPLGRIINRFAKDMG
DIDRTVAVFVNMFMGSIAQLLSTVILIGIVSTLSLWAIMPLLVVFYGAYLYYQNTSREIK
RMDSTTRSPVYAQFGEALNGLSSIRAYKAYDRMAEINGRSMDNNIRFTLVNMAANRWLGI
RLEVLGGLMVWLTASLAVMQNGKAANQQAYASTMGLLLSYALSITSSLTAVLRLASLAEN
SLNSVERVGNYIEIPSEAPLVIENNRPPPGWPSSGSIKFEDVVLRYRPELPPVLHGVSFL
ISPMDKVGIVGRTGAGKSSLLNALFRIVELEKGRILIDECDIGRFGLMDLRKVLGIIPQA
PVLFSGTVRFNLDPFSEHNDADLWESLERAHLKDTIRRNPLGLDAEVTEAGENFSVGQRQ
LLSLARALLRRSKILVLDEATAAVDVRTDVLIQKTIREEFKSCTMLIIAHRLNTIIDCDK
VLVLDSGKVQEFSSPENLLSNGESSFSKMVQSTGTANAEYLRSITLENKRTREANGDDSQ
PLEGQRKWQASSRWAAAAQFALAVSLTSSHNDLQSLEIEDDNSILKKTKDAVVTLRSVLE
GKHDKEIEDSLNQSDISRERWWPSLYKMVEGLAVMSRLARNRMQHPDYNLEGKSFDWDNV
EM
NT seq 4869 nt   +upstreamnt  +downstreamnt
atggggtttgagccgttggattggtattgcaagccggtgccgaatggtgtgtggactaaa
actgtggattatgcgtttggtgcatacacgccttgtgctattgactcttttgtgcttggt
atctctcatctggttctgttgattctgtgtctttatcgcttgtggctcatcacgaaggat
cacaaagtggataagttctgcttgaggtctaaatggtttagctattttctggctcttttg
gctgcttatgctactgcggagcctttgtttagattggtcatgaggatctctgttttggat
ttggatggagctgggtttcctccctatgaggcgtttatgttggtccttgaggcttttgct
tggggttctgctttggtcatgactgttgtggaaactaaaacgtatatccatgaactccgt
tggtatgtcagattcgctgtcatttatgctcttgtgggagacatggtgttgttaaatctt
gttctctctgttaaggagtactatggcagttttaaactgtatctttacataagcgaggtg
gcagttcaggttgcatttggaaccctcttgtttgtgtatttccctaatttggacccttac
cctggttacacaccagttgggactgaaaattccgaggattacgagtatgaagagcttcct
ggaggagaaaatatatgtcctgagaggcatgcaaatttatttgacagtatcttcttctca
tggttgaacccattgatgactctgggatcaaaacgacctctcaccgagaaggatgtatgg
catctggacacttgggataaaactgaaactcttatgaggagcttccagaagtcctgggat
aaggaactagaaaagcccaaaccgtggcttttgagagcactgaacaacagccttggggga
aggttttggtggggtggcttttggaagattgggaatgactgttcacagttcgtggggcct
cttctactgaatgagctcttaaagtcaatgcaacttaatgaaccagcgtggataggttac
atctatgcaatctcaatctttgttggagtggtattgggggttttatgtgaagctcagtat
ttccaaaatgtgatgcgtgttggttaccggcttaggtctgcactgattgctgctgtgttc
cgaaaatctttgaggctaactaatgaggggcggaagaagtttcaaacaggaaaaataaca
aacttaatgactactgatgctgagtcgctgcagcaaatctgccaatcacttcataccatg
tggtcggcgccatttcgtataattgtagcactggttctcctctatcaacaattgggtgtt
gcctcgatcattggtgcattgtttcttgtccttatgttccccatacagactgttattata
agcaaaacgcagaagttaacaaaagaagggttgcagcgtactgacaagagaattggccta
atgaatgaggttttagcggcaatggatacagtgaagtgttacgcttgggaaaacagtttt
cagtccaaggttcaaactgtacgtgatgatgaattatcttggttccggaaagcacaactc
ctgtcagcgttcaatatgttcatactaaacagcattcctgtcctcgtgactgttgtttca
tttggtgtgttctcattgcttggaggagatctgacacctgcaagagcgtttacgtcactc
tctctattttctgtgcttcgcttccctttattcatgcttccaaacattataactcagatg
gtaaatgctaatgtatccttaaaccgtttggaggaggtactgtcaaccgaagagagagtt
ctcttaccgaatcctcccattgaacctggacagccagctatctcaataagaaatggatac
ttctcctgggattcaaaggcggataggccaacattgtcaaacatcaacctggacatacct
cttggcagcctagttgcggtagttggcagcacaggagaaggaaaaacctccctgatatct
gctatgcttggggaacttcctgcaagatctgatgcgactgttactcttagaggatcagtc
gcttatgttccacaagtttcatggatctttaacgcaacagtacgtgacaatatattgttt
ggggctccttttgaccaagaaaaatatgaaagggtgattgatgtgacagcactccagcat
gaccttgagttactgcctggaggtgacctcacggagatcggagaaaggggtgttaacatc
agtgggggacaaaagcagagggtttctatggctagggccgtttactcaaattcagacgtg
tgcatcttagatgacccattgagtgcccttgatgcgcatgttggtcagcaggtttttgaa
aaatgcataaaaagggaactagggcagacaacgagagtacttgttacaaatcagctccac
ttcctatcacaagtggataaaatcctacttgtccatgagggaacagtaaaagaggaagga
acatatgaagaattatgccatagtggcccgttgttccagaggttaatggaaaatgcaggg
aaggttgaagattattcagaagaaaatggagaagctgaagtagatcaaacatctgtaaaa
ccagttgaaaatgggaacgctaataatctgcagaaggatggaatcgagacaaagaattcc
aaagaaggaaactctgttcttgtcaagcgagaagaacgtgaaactggagttgtgagttgg
aaagtcctggagaggtaccagaatgcacttggaggtgcatgggtagtgatgatgctcgtt
atatgctacgtcttgactcaagtatttcgggtttcaagcagcacttggttgagtgagtgg
actgattcaggaaccccaaagactcatggacccctattctataatattgtctatgcgctt
ctttcgtttggacaggtctctgtgacattgatcaattcatattggttgattatgtccagt
ctatatgcagctaaaaagatgcatgatgctatgcttggttccatactaagggctccaatg
gtgttctttcaaaccaatccattaggacggataatcaatcgatttgcaaaagatatggga
gatattgatcgaactgtggcagtctttgtaaacatgtttatgggttcaatcgcacagctt
ctttcaactgttatcttgattggcattgtcagcactctgtccctgtgggccatcatgccc
ctgttggtcgtgttctatggagcttatctgtattaccagaacacatctcgggaaattaaa
cgtatggattccactacaagatcgccagtttatgctcaatttggtgaggcattgaatgga
ctatctagtatccgtgcttataaagcatatgacaggatggctgaaattaatggaaggtca
atggacaataacatcagattcacacttgtaaacatggctgcaaatcggtggctgggaatc
cgtttggaagttttgggaggtctcatggtttggttgactgcgtcattagccgtcatgcag
aacggaaaggcagcgaaccaacaagcatatgcatctacgatgggtttgcttctcagttat
gcgttaagcattaccagctctttaacagctgtactgagactcgcgagtctagctgagaat
agtttaaactcggttgagcgtgttggaaattatatcgagataccatcagaggctccattg
gtcattgaaaacaaccgtccacctcccggatggccatcatctggatccataaaatttgag
gatgttgttcttcgttaccgccctgagttacctcctgttcttcatggagtttcgttcttg
atttctccaatggataaggtgggaattgttgggaggacaggcgctgggaaatcaagcctc
ttaaatgccttattcaggattgtggagctggaaaaaggaaggattttaattgatgaatgc
gacattggaagatttggactgatggacctacgtaaagtgctcggaattataccgcaagcg
ccagttcttttctcaggtaccgtgagattcaatcttgacccatttagtgaacacaacgac
gccgatctctgggaatctcttgagagggcacacttgaaagatactatccgcagaaatcct
cttggtcttgatgctgaggtaactgaggcaggagagaatttcagtgttggacagagacag
ttgttgagtcttgcacgtgcattgttacgaagatctaagatacttgttcttgatgaagca
actgctgcagttgacgtaagaactgatgttctcatccaaaagaccatccgagaagaattc
aagtcatgcacaatgctaatcatcgctcatcgtctcaatactatcatcgactgtgacaaa
gttcttgtccttgattctggaaaagttcaggaattcagttcaccggagaatcttctttca
aatggagaaagttctttctcgaagatggttcaaagtacaggaactgcaaacgcggagtac
ttacgtagtataacactagagaacaaacgtaccagagaagctaacggtgatgattcacaa
cctttagaaggtcaaaggaaatggcaagcttcttctcgttgggctgcagctgctcaattt
gcattggctgtgagcctcacttcatctcacaacgacctccaaagccttgaaatcgaagat
gataacagtattttgaagaaaacaaaggacgccgtcgtcactctacgcagtgtccttgaa
gggaaacatgataaagagattgaagactctctaaaccaaagtgacatctctagagagcgt
tggtggccatctctttacaaaatggtcgaagggcttgccgtgatgagcagattggcgagg
aacagaatgcaacacccggattacaatttagaagggaaatcgtttgactgggacaatgtc
gagatgtaa

DBGET integrated database retrieval system