KEGG   Arabidopsis thaliana (thale cress): AT1G30845Help
Entry
AT1G30845         CDS       T00041                                 

Definition
(RefSeq) cell growth defect protein
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: EamA DUF1774 Peptidase_U4
Motif
Other DBs
NCBI-GeneID: 839968
NCBI-ProteinID: NP_683335
MIPS: AT1G30845.1
TAIR: AT1G30845
Araport: AT1G30845
UniProt: Q3C1C7
Position
1
AA seq 118 aa AA seqDB search
MADAHLKQRGYISAVAAGLNAALAAISAKFFTSLVIKYGLVVICNVVMWACYVNSLRALS
SLQATVTNFAANFLSSGLAGLFLFQESLSFRWFAGALSITTGVLILSKSSVDKKVSSD
NT seq 357 nt NT seq  +upstreamnt  +downstreamnt
atggctgatgcacatttgaagcaaagaggctatatctcggcagttgcagctggactcaat
gcagctcttgcagcaatctctgctaagttcttcacatctcttgtgattaagtatggatta
gttgtaatctgcaatgtggttatgtgggcatgttatgtaaacagtttaagagctttgtcc
tctctacaagctactgtcacaaactttgctgctaattttctatcttctggtttagctggt
ctctttctttttcaagaatcgttatcgtttcgttggtttgcgggagctttatcgattact
accggagttcttatcctcagtaagtcgagtgtcgataagaaggtaagctcggattaa

DBGET integrated database retrieval system