KEGG   Arabidopsis thaliana (thale cress): AT1G32270Help
Entry
AT1G32270         CDS       T00041                                 

Gene name
ATSYP24
Definition
(RefSeq) syntaxin
Organism
ath  Arabidopsis thaliana (thale cress)
SSDB OrthologParalogGFIT
Motif
Pfam: SNARE LEA_2 Syntaxin_2 Syntaxin
Motif
Other DBs
NCBI-GeneID: 840119
NCBI-ProteinID: NP_174506
MIPS: AT1G32270.1
TAIR: AT1G32270
Araport: AT1G32270
UniProt: Q9C615
Position
1
AA seq 416 aa AA seqDB search
MVRSNDVKFQVYDAELTHFDLESNNNLQYSLSLNLSIRNSKSSIGIHYDRFEATVYYMNQ
RLGAVPMPLFYLGSKNTMLLRALFEGQTLVLLKGNERKKFEDDQKTGVYRIDVKLSINFR
VMVLHLVTWPMKPVVRCHLKIPLALGSSNSTGGHKKMLLIGQLVKDTSANLREASETDHR
RDVAQSKKIADAKLAKDFEAALKEFQKAQHITVERETSYIPFDPKGSFSSSEVDIGYDRS
QEQRVLMESRRQEIVLLDNEISLNEARIEAREQGIQEVKHQISEVMEMFKDLAVMVDHQG
TIDDIDEKIDNLRSAAAQGKSHLVKASNTQGSNSSLLFSCSLLLFFFLSGDLCRCVCVGS
ENPRLNPTRRKAWCEEEDEEQRKKQQKKKTMSEKRRREEKKVNKPNGFVFCVLGHK
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atggttagatccaacgatgtgaaattccaagtctacgacgctgagctgacacatttcgat
ctcgaaagcaacaataacctccagtacagtctctctttgaatctctccatccgaaactcg
aagagtagtatcggaatccattacgataggtttgaagcaaccgtttactacatgaatcag
cggttaggagctgttcccatgccgttgttctaccttggaagcaagaacacgatgcttctc
agagcattgtttgaaggccaaactctagttttactaaagggtaatgaacgcaaaaagttt
gaagatgatcagaagactggtgtttatagaattgacgtgaagctgagtattaattttagg
gttatggttttgcatttagtcacgtggccgatgaaaccagttgttcgttgtcatcttaag
ataccattagcattaggttcctctaactcaaccggagggcacaagaaaatgttacttatt
ggtcaactggtaaaagatacttctgcaaatcttagggaagctagtgaaaccgatcatcgt
cgagatgttgctcaaagtaagaagattgcagatgctaaacttgcaaaggattttgaagca
gcgttgaaagagtttcagaaagcacagcatattacagttgaaagagaaacttcttatatt
ccttttgatccaaaaggtagcttttcttcaagtgaggtagacattggctatgatagatca
caagagcagcgtgtcctcatggaatctagaaggcaagaaattgtgttgcttgacaacgaa
atttccttaaacgaagcacggatagaggcaagggaacaggggatacaggaagttaagcat
caaatcagtgaagtaatggagatgttcaaagatctggcggtgatggtagaccatcaagga
acgatcgatgatatagatgagaagatcgacaatttacgttcagcagcagctcagggaaag
tcccatctcgtgaaagcatccaatacacaaggatcaaactcatccctgttgttttcatgt
tccttacttctctttttctttctttctggtgatttatgcagatgtgtttgtgttggaagt
gagaatcctagattaaatcctacaagaagaaaagcttggtgtgaagaagaagatgaagaa
caaaggaagaagcaacagaagaagaagacgatgtcggagaagagacgtcgtgaagagaag
aaagtcaacaaaccaaatgggtttgtgttttgtgtgttgggccataagtga

DBGET integrated database retrieval system