KEGG   Arabidopsis thaliana (thale cress): AT1G32640Help
Entry
AT1G32640         CDS       T00041                                 

Gene name
MYC2
Definition
(RefSeq) Basic helix-loop-helix (bHLH) DNA-binding family protein
  KO
K13422  transcription factor MYC2
Organism
ath  Arabidopsis thaliana (thale cress)
Pathway
ath04016  MAPK signaling pathway - plant
ath04075  Plant hormone signal transduction
Brite
KEGG Orthology (KO) [BR:ath00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04016 MAPK signaling pathway - plant
    AT1G32640 (MYC2)
   04075 Plant hormone signal transduction
    AT1G32640 (MYC2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:ath03000]
    AT1G32640 (MYC2)
Transcription factors [BR:ath03000]
 Eukaryotic Type
  Basic helix-loop-helix (bHLH)
   HLH domain only
    AT1G32640 (MYC2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: bHLH-MYC_N HLH
Motif
Other DBs
NCBI-GeneID: 840158
NCBI-ProteinID: NP_174541
MIPS: AT1G32640.1
TAIR: AT1G32640
Araport: AT1G32640
UniProt: Q39204 A0A178W7C3
Structure
PDB: 

Position
1
AA seq 623 aa AA seqDB search
MTDYRLQPTMNLWTTDDNASMMEAFMSSSDISTLWPPASTTTTTATTETTPTPAMEIPAQ
AGFNQETLQQRLQALIEGTHEGWTYAIFWQPSYDFSGASVLGWGDGYYKGEEDKANPRRR
SSSPPFSTPADQEYRKKVLRELNSLISGGVAPSDDAVDEEVTDTEWFFLVSMTQSFACGA
GLAGKAFATGNAVWVSGSDQLSGSGCERAKQGGVFGMHTIACIPSANGVVEVGSTEPIRQ
SSDLINKVRILFNFDGGAGDLSGLNWNLDPDQGENDPSMWINDPIGTPGSNEPGNGAPSS
SSQLFSKSIQFENGSSSTITENPNLDPTPSPVHSQTQNPKFNNTFSRELNFSTSSSTLVK
PRSGEILNFGDEGKRSSGNPDPSSYSGQTQFENKRKRSMVLNEDKVLSFGDKTAGESDHS
DLEASVVKEVAVEKRPKKRGRKPANGREEPLNHVEAERQRREKLNQRFYALRAVVPNVSK
MDKASLLGDAIAYINELKSKVVKTESEKLQIKNQLEEVKLELAGRKASASGGDMSSSCSS
IKPVGMEIEVKIIGWDAMIRVESSKRNHPAARLMSALMDLELEVNHASMSVVNDLMIQQA
TVKMGFRIYTQEQLRASLISKIG
NT seq 1872 nt NT seq  +upstreamnt  +downstreamnt
atgactgattaccggctacaaccaacgatgaatctttggaccaccgacgacaacgcttct
atgatggaagctttcatgagctcttccgatatctcaactttatggcctccggcgtcgacg
acaaccacgacggcgacgactgaaacaactccgacgccggcgatggagattccggcacag
gcgggatttaatcaagagactcttcagcaacgtttacaagctttgattgaaggaacacac
gaaggttggacctacgctatattctggcaaccgtcgtatgatttctccggcgcctccgtg
ctcggatggggagatggttattacaaaggtgaagaagataaagcaaacccgagacggaga
tcgagttcgccgccgttttctactccggcggatcaggagtacaggaaaaaagtgttgaga
gagcttaactcgttgatctccggtggtgttgctccgtcggatgacgctgttgatgaggag
gtgacggatacggaatggtttttcttggtttcgatgacgcagagcttcgcttgcggtgcg
ggattagctggtaaagcgtttgcaacgggtaacgcggtttgggtttccgggtcagatcaa
ttatccgggtcgggttgtgaacgggctaagcaaggaggagtgtttgggatgcatactatt
gcgtgtattccttcggcgaacggagttgtggaagtcgggtcaacggagccgatccgacag
agttcggaccttattaacaaggttcgaattcttttcaatttcgacggcggagctggagat
ttatcgggtcttaattggaatcttgacccggatcaaggtgagaacgacccgtctatgtgg
attaatgacccgattggaacacctggatctaacgaaccgggtaacggagctccaagttct
agctcccagcttttttcaaagtctattcagtttgagaacggtagctcaagcacaataacc
gaaaacccgaatctggatccgactccgagtccggttcattctcagacccagaatccgaaa
ttcaataacactttctcccgagaacttaatttttcgacgtcaagttctactttagtgaaa
ccaagatccggcgagatattaaacttcggcgatgaaggtaaacgaagctccggaaacccg
gatccaagttcttattcgggtcaaacacaattcgaaaacaaaagaaagaggtcgatggtt
ttgaacgaagataaagttctatcattcggagataaaaccgccggagaatcagatcactcc
gatctagaagcttccgtcgtgaaagaagtagcagtagagaaacgtccaaagaaacgagga
agaaagccagcaaacggtagagaagagccactaaaccacgtcgaagcagagagacaaaga
cgcgagaaactaaaccaaagattctacgcgttacgagcggttgtaccaaacgtttcaaaa
atggataaagcttcgttactcggtgacgcaatcgcttacatcaacgagcttaaatccaaa
gtagtcaaaacagagtcagagaaactccaaatcaagaaccagctcgaggaagtgaaactc
gagctcgccggaagaaaagcgagtgctagtggaggagatatgtcgtcttcgtgttcttcg
attaaaccggtggggatggagattgaagtgaagataattggttgggacgcaatgattaga
gttgaatctagtaagaggaatcatccggcggcgaggttgatgtcggcgttgatggatttg
gagttggaagtgaatcacgcgagtatgtcggtggttaacgatttgatgattcaacaagcg
acggtgaagatgggttttaggatctatacgcaagaacagctcagagcaagtttgatttca
aaaatcggttaa

DBGET integrated database retrieval system